KEGG   Azotobacter vinelandii DJ: Avin_19850Help
Entry
Avin_19850        CDS       T00885                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
avn  Azotobacter vinelandii DJ
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:avn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Avin_19850 (recR)
DNA repair and recombination proteins [BR:avn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Avin_19850 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1973188..1973787
Genome map
AA seq 199 aa AA seqDB search
MSFSPLIRQLIDALRILPGVGQKTAQRMALHLLERDRSGGLRLAQALTQALEHVGHCRQC
RTLSEDELCPQCADPRRDDSLLCVVQGPMDVFAIEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPELLARVEQGAFEEVIIATNPTVEGEATAHYIAQTLASSDVTVSRIAHGVPLGGELE
LVDGGTLSHALAGRRPIDL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagtccgctgatccgacaactcatcgatgccctgcgcatccttcccggggtg
ggacagaagaccgcccagcgcatggctctgcatctgctcgaacgtgatcgcagcggcggc
ttgcgtttggctcaggcgctcacccaggcgctcgagcatgtcggtcattgccggcaatgc
cggaccctgagcgaggacgaactctgtccgcagtgcgctgatccgcgtcgcgacgattcc
ctgctctgtgtggtgcagggaccgatggacgtattcgccatagagcaaacgggctaccgt
ggccgctatttcgtgctcaagggacacctttcccccctggacggcctcggcccagaggct
attggcattcctgagttgttggcgcgagtcgagcagggagctttcgaggaagtgatcatc
gccaccaatccaacggtggaaggcgaggctacggctcattacatcgcgcagactctggcg
tccagcgatgtcacggtttcccgtatcgcccatggtgtgccgctgggcggcgaactggag
ttggtggacggcggtaccttgagccacgctctggccggacgcaggccgatcgatctgtga

DBGET integrated database retrieval system