KEGG   Azotobacter vinelandii DJ: Avin_20730Help
Entry
Avin_20730        CDS       T00885                                 

Definition
dTDP-4-dehydrorhamnose reductase RmlD
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
avn  Azotobacter vinelandii DJ
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2062207..2063229)
Genome map
AA seq 340 aa AA seqDB search
MPIGTRIKDYSDGNVVKILVTGATGFVGSAVVRRLLRDDHHVRVLVRASSDRRNLQDLNV
QVVEGDLTQAASLQHACDGCDALFHVAADYRLWAPFPEQLYRTNVEGTRVILEAAKSAGV
PRIVYTSSVATLGIPKDGRPGDENTAVTERDMIGHYKRSKFLAESLVREFAAEGLPVVIV
NPSTPIGPRDIKPTPTGRIVRDAIAGRLPAYVDTGLNIVHVDDVAEGHWLAFQHGVVGER
YILGGQNLTLREMLAEIADIAGLAPPRWRLPHAAVMPIAHLAEVWARLSGTQPIATVEEV
RMSRKYMFFSSAKAERELGYTPGPVRLAMEDAVMWFRQHR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatcggcacccgaatcaaagattattctgatggtaatgtcgtgaagatattagta
accggagccaccggttttgtcggttcggccgtggtgcgtcgtctcctgcgcgatgatcat
catgtgcgcgtgctggtgcgagccagttcggatcgtcgcaacctgcaagatttaaacgtg
caggttgtcgaaggagatctcacccaggcggcttcattgcaacacgcttgtgacggctgc
gatgccctgttccacgtggcagccgattacaggctgtgggcgccgtttcccgaacaactc
taccgtaccaacgtcgagggcacgcgcgtcatactcgaggctgccaagtcggcaggcgtg
ccacgtatcgtctataccagcagcgtcgctacccttggcatccccaaggacggccgtcct
ggcgacgagaacacggccgtgacagagcgtgacatgatcggacactacaagcgctccaag
tttctcgccgagtcgctggtcagggagttcgccgccgagggcctgccagtggtgatcgtc
aatccttcgaccccgatcgggccgcgcgacatcaaacccacccccactggccggatcgtg
cgcgatgccattgccggtcgcctgcctgcctatgtcgacaccggtctcaatatcgtgcat
gtggacgatgtagccgaaggacactggctagcgttccagcacggtgtcgtaggcgagcgc
tacattctgggcgggcagaatctcaccttgcgcgagatgctcgccgagatcgccgacatt
gccgggctcgcgccgccccgctggagactgccgcacgcagcggtcatgcccatagcccac
cttgcggaggtttgggcacgcctgagcggaacccagccgatcgcgacggtggaagaggta
cgcatgtccaggaaatacatgttcttctccagcgccaaagccgaacgcgaactcggctat
acaccggggcccgtccgcctggcgatggaggatgcagtgatgtggttcagacagcaccgc
tag

DBGET integrated database retrieval system