KEGG   Azotobacter vinelandii DJ: Avin_23070Help
Entry
Avin_23070        CDS       T00885                                 

Definition
Arylesterase protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Avin_23070
Enzymes [BR:avn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Avin_23070
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Avin_23070
Lipid biosynthesis proteins [BR:avn01004]
 Fatty acid synthase
  Component type
   Avin_23070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2304194..2304790
Genome map
AA seq 198 aa AA seqDB search
MLGAMLASLFFWAQGALAGTVLVVGDSISAALGVETSQGWVALLERRLTERGLEHRVVNA
SISGDTSAGGLARLPGLLAAHRPELVIIELGGNDGLRGQPPQQLQQNLASMIDRSRSVGA
RVLLLGVQLPPNYGSRYNQAFIRVYASLAEEKQVPLVPFFLEGVGGVPGMMQADGIHPTA
RAQPQLLDNLWPTLEPLL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgctgggcgccatgctggcgtcgctgttcttctgggcgcaaggggcgctggcgggtacc
gttctggtcgtcggcgatagtatcagcgccgctctgggtgtggaaaccagccagggctgg
gtcgctctgctggaaaggcgtctcaccgagcggggcttggagcaccgggtagtgaacgcc
tcgatcagcggcgacaccagtgccggcggcctcgcgcgccttcccgggctgctcgccgct
caccgtccggagctggtgatcatcgagctggggggaaacgacgggctgcgcggacagcct
ccacagcaattgcaacagaatcttgcatcgatgatcgaccgctcgcgatccgttggggca
cgggtcttgctgctcggcgtgcagctcccgccgaactacggctcccgctacaaccaggcg
ttcattcgggtctatgcgtcgctggccgaggagaagcaggtgccgctggtgccattcttt
ctcgaaggagtggggggagtgcccggaatgatgcaggccgatggcatccatccgaccgca
cgggcccagccgcagctgctggacaatctctggcccaccctggagccattgctctga

DBGET integrated database retrieval system