KEGG   Azotobacter vinelandii DJ: Avin_23410Help
Entry
Avin_23410        CDS       T00885                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:avn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:avn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:avn00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:avn00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:avn00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:avn00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:avn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2342007..2342945
Genome map
AA seq 312 aa AA seqDB search
MEFAMSCIVTLTLNPAMDVSTAVARLEPTRKLRCGPPRYEPGGGGINVARVIRALGGESV
AVYPAGGPFGEMLQHALEALGLPQVRVPIAGDTRESFTVDEGETGLQYRFVLPGPTLTPT
ERRNCLETIAALVPAPSHLVVSGSFPSGVALDFHDEILDLARRLGARLVLDYSGEALRHA
VARGGIYLLKPSLSELSSLAGRRLDDEAGQEEEARRLVERGAVEIVVLSLGAGGALLASR
EGIERFSAFDVPLRSAVGAGDSVVGATVLALSRGWSLHDAVRYGMAAAAATLMRPGTGLC
RAEDVERLYREG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ctggagttcgccatgtcgtgtatcgtcaccttgaccctgaacccggcgatggatgtctcg
accgccgttgcgcggctcgagccgacccgcaagctgcgttgtggtccgccgcgctacgag
ccgggcggtggcgggatcaacgtggcgcgagtgatccgggcactcggcggcgagagcgtg
gcggtctatccggccggcggtccgttcggcgagatgctgcagcatgcgctggaggcgctc
ggtctgccccaggtgcgggtgccgatcgctggcgatacccgggaaagtttcaccgtggac
gagggtgaaaccggcctgcagtaccgtttcgtcctgcccggcccgaccttgactccgacg
gagcggcggaactgtctggaaaccatcgccgcgcttgtgccggcgccatcccatctggtc
gtcagtggcagttttccgtccggcgtggcgctggatttccacgacgaaatcctggatctg
gcgcggcgcctgggggcgaggctggtgctcgactactcgggagaggccctgcgccatgcg
gtggcccgcggaggtatctacctgctcaagccgagcctgagcgagctctccagcctggcg
gggcggcgactggacgacgaggccggacaggaggaggaggcacgccggctggtcgagcgg
ggcgcggtggagatcgtcgtcctgtccctcggcgccggcggcgcgctgctggcgagccgg
gaaggcatcgagcgcttttccgccttcgacgtgcccttgcgcagtgcggtgggggccggc
gacagcgtggtcggcgccacggtactcgccttgagtcgcggctggagcctgcacgatgcg
gtgcgctacggcatggccgcggcggccgcgaccctgatgcgccccggcaccgggctgtgc
cgggcggaagatgtcgagcgcctgtatcgcgagggctaa

DBGET integrated database retrieval system