KEGG   Azotobacter vinelandii DJ: Avin_24990Help
Entry
Avin_24990        CDS       T00885                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Avin_24990 (galU)
   00052 Galactose metabolism
    Avin_24990 (galU)
   00500 Starch and sucrose metabolism
    Avin_24990 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Avin_24990 (galU)
Enzymes [BR:avn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Avin_24990 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2501803..2502642
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPIVNKPLIQYGVEEALDAGLTQVAMVTGRGKR
ALEDHFDISYELEHQIRDTDKEKYLIGIRRLIDSCTFSYTRQVEMKGLGHAILCGRPLIG
DEPFAVVLADDLCINLEGDGVLTQMVKLYNQFRCSIVAIQEVPPEETSKYGVIAGEMIRD
DIYRVSSMVEKPKPEDAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALMKQAKD
GCVMAYKFKGKRFDCGGAEGYIEATNFCFENLYKLGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcctgtttcccgccgccggttacggtacccgcttcctgcccgccacc
aaggcgatgcccaaggaaatgctgccgatcgtgaacaagccgctgatccagtacggggtc
gaggaagcgctggatgccggcctgacgcaggtcgcgatggtcaccggccgtggaaaacgc
gcactcgaagaccacttcgacatcagctatgaactcgaacatcagatccgcgacaccgac
aaggaaaaatacctgatcggcattcgccggctgatcgactcctgcaccttctcctatacc
cgccaggtcgagatgaagggcctcggccatgcgattctctgcggccgtccgctgatcggc
gacgagcctttcgccgtggtgctggccgacgacctgtgcatcaacctcgagggcgacggt
gtactgacccagatggtcaagctgtacaaccagttccgctgctcgatcgtggcgatccag
gaagtgccgccggaagaaacttccaagtacggggtcatcgccggggagatgatccgcgac
gatatctaccgggtcagctccatggtggagaagccgaagccggaagacgccccttcgaat
ctggcgatcatcggccgttacatcctgacgccggacatcttcgaactgatcgagcagacc
gagcccggcaagggtggcgagatccagatcaccgacgcgctgatgaagcaggccaaggac
ggatgcgtgatggcctacaagttcaagggcaagcgcttcgactgcggtggcgccgaggga
tacatcgaggccaccaatttctgcttcgagaacctgtacaagctcggcaaggcctactga

DBGET integrated database retrieval system