KEGG   Azotobacter vinelandii DJ: Avin_26980Help
Entry
Avin_26980        CDS       T00885                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:avn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2767609..2770074
Genome map
AA seq 821 aa AA seqDB search
MQQPARFRKTLLSVLIGALGIAQAAGAANMAPGAPGAAPFWSYSGKTGIGTSYEQYEDGQ
YSPQAATGEVSKVWFSLARGVVTETMFGLIHEAQLREMQLVIQGPDFLDLEAQDTDSEIH
YLSVDDQGRPTSLAYKIVNRDRQGRYEIEKHIFTDPDADSLVIRVIFRSQEPGIQAYVHI
DPAIGNDGSGDSAFVDGQALYAREGETTLVVKASRPLEQPTVGFAGVSDGLTDLKDGKLE
NRYDSTGDAAGNVTMLARLPLAGSETTLDLVVGFGKNRQQADRAADATLARGYAEVLAHY
NGEGEAIGWRDYLASLSGLPAMYAQSADNGKLLNVSAMVLKAQEDKSNAGALIASLSNPW
GETVPAESGTTGYKAVWPRDFYQCAMALLALGDRQTPQVAFEYLKKVQVSEATSLTQGDT
SAYIHEQKQEGKTEDAGPGATGWFLQKTHVDGEIEWVGVQLDQTAMPIMLGYKLWKAGIL
DDARIKHWYQNMLKPAAEFLTRGGQVKVGWNDWKVVPPQTQQERWEEQWGYSPSTTAAVI
AGLVAASEVAGHAGDGEAAQRFLDAAKGYSDKLEASMVTRKGSLGDGHYYLRITQNDDPD
DGAPLLDNNSRPGLPEHQVLDAGFLELVRYGVRPATDPNIVGSLDELDSQELPENLKVKY
LFSYPGVEGEFPGWRRYGNDGYGESEISAINFPATEAPQMNSGLRGRVWPIFTGERGHYE
LARSKARLPAGIEALSAEQLAQLRNTYVKAMELFANEGLMLPEQVWDGVGDNSRHGYVKG
EGTDSATPLAWSHAEYVKLVRSLTDQKVWDHYPVVPEKLAR
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaccagctagattccgcaaaacactgctgagcgtcctgatcggcgcactggga
atcgcccaggccgccggggcggccaacatggcccccggcgcgccgggcgcggcgccgttc
tggtcctattcgggcaagaccggcatcggtacttcctacgagcagtacgaggacggccag
tactcgccgcaagcggccaccggcgaagtctcgaaggtctggttctccctggcccggggg
gtcgtcaccgaaaccatgttcgggctgatccacgaagcccagctccgcgaaatgcaactg
gtgatccagggccccgacttcctggacctggaagcgcaggacaccgacagcgagatccac
tatctgtcggtcgacgatcagggccgccccacctcactggcctacaagatcgtcaaccgc
gacaggcagggccgctacgagatcgagaagcacatcttcaccgacccggacgccgattcg
ctggtgatacgggtcatcttccgcagccaggagccgggcatccaggcctatgtgcacatc
gatccggccatcggcaacgacggcagtggcgacagcgccttcgtcgacgggcaggcgctg
tacgcccgggagggcgagaccaccctggtggtcaaggccagccgccctctggaacaaccc
accgtcggcttcgccggagtttccgacggcctgaccgacctcaaggacggcaagctcgaa
aaccgctacgacagcaccggggatgctgctggtaacgtcaccatgctggcccgcctgccc
ttggcgggcagcgaaaccaccctcgacctggtggtcggcttcggcaagaaccgccagcag
gccgaccgggcggcagatgcgacgctggcgcgcggctacgccgaggtgctggcccactac
aacggcgagggcgaggcgatcggctggcgggactacctggcctccctttccggcctgccg
gccatgtacgcgcagagtgccgacaacggcaagctgctcaacgtcagcgccatggtgctc
aaggcacaggaagacaagagcaacgccggagcgctgatcgcctccctgtccaacccctgg
ggcgagacggtgccggcggaaagcggcaccaccggctacaaggcggtctggccgcgcgat
ttctaccagtgcgcgatggcgctgctggccctcggcgaccggcagacaccgcaggtcgcc
ttcgaatacctgaagaaggtccaggtcagcgaagccacctctctcacgcagggcgacact
tcggcctacatccacgagcagaagcaggaaggcaagaccgaagacgccggccccggcgcc
accggctggttcctgcagaagacccacgtcgatggcgagatcgaatgggtcggggtccag
ctcgaccagaccgccatgcccatcatgctgggatacaagctgtggaaggccgggatactg
gacgacgcccggatcaagcactggtaccagaacatgctcaagccggcggcggaattcctg
accaggggcggccaggtgaaggtcggctggaacgactggaaggtcgtcccgccgcagacc
cagcaggaacgctgggaagagcaatggggctactcgccctcgaccacggcggcggtcatc
gccggcctggtggcggcctccgaagtcgccggccatgccggggatggcgaggcggcgcag
cgtttcctggacgccgcgaagggctattccgacaagctggaggcgagcatggtcacccgg
aaaggcagcctgggtgacgggcactactatctgcgcatcacccagaacgacgaccccgac
gacggcgcccccctgctcgacaacaacagccgccccggattgccggaacatcaggtgctc
gatgccggcttcctggagctggtgcgctacggcgtacgccccgccaccgacccgaacatc
gtcggcagcctggacgaactcgatagccaggagctgccggaaaacctgaaggtcaaatac
ctgttcagctatccgggcgtcgagggcgaattccccggctggcgccgctacggcaacgac
ggctacggcgagagcgaaatttccgccatcaacttcccggccaccgaggccccgcagatg
aactccgggctgcgcggccgcgtctggccgatcttcaccggcgagcgcggccattacgag
ttggcccgcagcaaggcccgcttgccggcaggaatcgaggcactgagcgccgagcaactg
gcgcagttgaggaacacttacgtcaaggccatggagctgttcgccaacgagggcctgatg
ctgccggagcaggtctgggacggcgtaggcgacaacagccgccacggctacgtgaagggc
gaaggcacggactcggccacgcccctggcctggagccatgccgaatacgtcaagctggtc
cgctcgctgaccgaccagaaggtctgggatcactacccggtcgtcccggaaaaactcgcc
agatga

DBGET integrated database retrieval system