KEGG   Azotobacter vinelandii DJ: Avin_28420Help
Entry
Avin_28420        CDS       T00885                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:avn01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:avn00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2926482..2928077
Genome map
AA seq 531 aa AA seqDB search
MSAYQNEIKALAALKEKNGSAWSAINPEYAARMRIQNRFKTGLDVAKYTAAIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTDKKYLYLSGWMVAALRSDFGPLPDQSM
HEKTAVSSLIEELYTFLRQADARELDLLFSALDDARNAGDKAKEQEILKQIDGFETHVVP
IIADIDAGFGNAEATYLLARKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKI
NAVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTRQEGDLGDKYNAFLDCEEISPAEMK
NGDVVLNRNGKLLRPKRLASGLFQFRKGTGEDRCVLDCITSLQNGADLLWIETEKPHIGQ
IKGMVDRIREAIPNAKLVYNNSPSFNWTLNFRQQVFDTWAAEGKDVAKYDRAKLMSVEYD
ETELALEADARIRTFQRDAAAQAGIFHHLITLPTYHTAALSTDNLAKGYFAEEGMLAYVK
GVQRQEIRQSIACVKHQNMAGSDIGDNHKEYFAGEAALKAGGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcatatcaaaacgagatcaaggcccttgctgccctcaaagagaagaacggcagc
gcctggagcgccatcaacccggaatacgccgcccgcatgcgcatccagaaccgtttcaag
accggtctggacgtcgccaagtacactgcggccatcatgcgcaaggacatggccgagtac
gacgccgattcgtccgtctacacacagtccctgggctgctggcacggtttcatcggccag
cagaagctgatctccatcaagaagcacctgaagaccaccgacaagaagtacctgtacctg
tccggctggatggtggcagccctgcgctccgacttcggcccgctgcccgaccagtccatg
cacgagaagaccgcggtctcctcgctgatcgaagagctgtacaccttcctgcgccaggcc
gatgcccgcgaactggacctgctgttcagcgcccttgacgatgcccgcaacgccggcgac
aaagccaaggagcaggaaatcctgaagcagatcgacggcttcgaaacccacgtcgtgccg
atcatcgccgacatcgacgccggctttggtaacgccgaggccacctacctgctggccagg
aagatgatcgaagccggtgcctgctgcatccagatcgaaaaccaggtttccgacgagaag
cagtgcggccaccaggacggcaaggtgaccgttccgcacgaggacttcctcgccaagatc
aatgccgttcgctatgccttcctcgagctgggcgtggacgatggcgtgatcgtcgcccgt
accgactccctgggtgccggcctgaccaagcagatcgccgtgacccgtcaggaaggcgac
ctgggcgacaagtacaacgccttcctggactgcgaagagatcagcccggccgagatgaag
aacggcgacgtggtactgaaccgcaacggcaagctgctgcgtccgaagcgcctggccagc
ggtctgttccagttccgcaagggtaccggcgaagaccgctgcgtcttggactgcatcact
tccctgcagaatggcgccgacctgctgtggatcgaaaccgagaagccgcacatcggccag
atcaagggcatggtcgaccgcatccgcgaagccatcccgaacgccaagctggtgtacaac
aacagcccgtcgttcaactggaccctgaacttccgtcagcaagtgttcgatacttgggcc
gccgaaggcaaggacgtcgccaagtacgaccgcgccaaactgatgagcgtggagtacgac
gagaccgagctggccctggaagctgatgcccgcatccgcaccttccagcgcgacgccgcg
gcccaggccggtattttccaccacctgatcaccctgccgacctaccacactgccgcgctg
tccaccgacaacctggccaagggctacttcgccgaggaaggcatgctggcctacgtgaag
ggcgttcagcgtcaggaaatccgtcagagtatcgcttgcgtcaagcaccagaacatggcc
ggctccgacatcggcgacaaccacaaggaatacttcgctggcgaagccgctctgaaagcc
ggcggcaaagacaacaccatgaaccagttccattga

DBGET integrated database retrieval system