KEGG   Azotobacter vinelandii DJ: Avin_34530Help
Entry
Avin_34530        CDS       T00885                                 

Gene name
acsA1
Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00010  Glycolysis / Gluconeogenesis
avn00620  Pyruvate metabolism
avn00640  Propanoate metabolism
avn00680  Methane metabolism
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
avn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_34530 (acsA1)
   00620 Pyruvate metabolism
    Avin_34530 (acsA1)
   00640 Propanoate metabolism
    Avin_34530 (acsA1)
  Energy metabolism
   00680 Methane metabolism
    Avin_34530 (acsA1)
Enzymes [BR:avn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Avin_34530 (acsA1)
Lipid biosynthesis proteins [BR:avn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Avin_34530 (acsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACO79602
UniProt: C1DQG6
Position
complement(3527727..3529688)
Genome map
AA seq 653 aa AA seqDB search
MCAASLYPVRPEVVARSFTDEAAYKAMYQQSVINPDGFWREQARRLDWIKPFTKVKQTSF
DDHHVDIKWFADGTLNASYNCLDRHLEARGEQVAIIWEGDDPSAQRLITYRELHEEVCRF
ANALRGQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPDALAGRIADCRS
KVVITADEGLRGGKRVPLKANVDEALTNPDTYSVNKVIVCKRTGGDIKWHSHRDIWYEDL
LKVAGSICAPKEMGAEEPLFLLYTSGSTGKPKGVVHTTGGYLLYASLTHERVFDYRPGEV
YWCTADVGWVTGHSYIVYGPLANGATTLLFEGIPSYPDMTRISKIIDKHGVNILYTAPTA
IRAMMAQGRAPVEGADGSSLRLLGSVGEPINPEAWHWYYENIGRERCPIVDTWWQTETGG
ILITPLPGATSLKPGSASRPFFGVQPALVDNLGNLIEGAGEGNLVIIDSWPGQARSLHGD
HDRFVDTYFKTFKGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHP
QVAEAAVVGVPHDVKGQGIYVYVTLNDGVSASEALRQELKAWIRREIGPIATPDVIQWAP
GLPKTRSGKIMRRILRKISVGEYDGLGDISTLADPSVVQSLINIHRGMQAACA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccgcttccctctacccggtacgtcctgaagtagttgcccgatcctttaccgac
gaggccgcctacaaggccatgtatcagcagtcggtcatcaatcccgatggtttctggcgc
gaacaggccaggcgtctggactggatcaagccattcaccaaggtcaagcagacctccttc
gacgaccaccatgtcgatatcaagtggttcgccgatggcaccctgaacgcctcctacaac
tgcctggaccgtcacctcgaagcgcgcggcgagcaggtggccatcatctgggagggcgac
gatccgtccgcgcagcgcctgatcacctaccgcgagctgcacgaggaagtctgtcggttc
gccaacgccctgcgcggtcaggacgtgcatcgcggcgacgtggtgaccatctacatgccg
atgattccggaggccgtggtggccatgctggcctgcgcccgcatcggcgcgatccattcg
gtggtgttcggcggcttttctcccgacgcgctggccgggcgcatcgccgactgcaggtcg
aaggtggtgatcaccgccgacgaaggcctgcgcggcggcaagagggttccgctgaaggcc
aacgtcgacgaggcgttgaccaatccggacacctacagcgtcaacaaggtgatcgtctgc
aagcgcaccggtggcgatatcaagtggcactcgcatcgcgacatctggtacgaggacctg
ctgaaagtggccggcagcatctgcgcacccaaggaaatgggtgccgaggagccgctgttc
ctcctttatacctctggctcgaccggcaagccgaagggcgtggtgcacaccacgggcggc
tatctgctgtatgcctcgctgacccacgagcgggtgttcgactaccgtccgggcgaggtc
tactggtgcaccgccgacgtgggctgggtcaccggccacagctacatcgtctacggtccg
ctggccaacggcgccaccacgctgctgttcgagggcatccccagctacccggacatgacc
cggatttccaagatcatcgacaagcacggggtgaacatcctctataccgcgccgaccgcc
atccgcgccatgatggcccagggccgggcgccggtggagggcgccgacggttccagcctg
cgcctgctcggctcggtgggcgagccgatcaatccggaagcctggcactggtactacgag
aacatcggccgggagcgctgcccgatcgtcgacacctggtggcagaccgaaaccggcggc
atcctgatcaccccgctgccgggcgccacctcgctcaagccgggttcggcgagccgtcct
ttcttcggcgtacagccggcgctggtcgacaacctgggcaacctgatcgaaggggcgggc
gaaggcaacctggtgatcatcgattcgtggccggggcaggcgcgcagcctgcatggcgat
cacgaccgcttcgtcgacacctacttcaagaccttcaagggcatgtacttcaccggtgac
ggcgcccgccgcgacgaggacggctattactggatcaccggccgcgtcgacgacgtgctg
aacgtttccggtcaccgtatgggcaccgccgagatcgagagcgccatggtcgcccacccg
caggtcgccgaggcggcggtggtcggcgttccgcacgacgtcaaggggcaaggcatctat
gtctacgtcaccctgaacgacggggtgtcggcttccgaggcgctgcgccaggaactgaag
gcctggattcgccgggagatcggtccgatcgctacgccggacgtgatccagtgggcgccc
ggcttgccgaagacccgctcaggcaagatcatgcgtcgtatcctgcgcaagatctccgtt
ggcgaatacgacgggctgggcgacatctccaccctggccgatccgtcggtggtgcagagt
ctgatcaacatccatcgcggcatgcaggccgcctgcgcctga

DBGET integrated database retrieval system