KEGG   Azotobacter vinelandii DJ: Avin_36700Help
Entry
Avin_36700        CDS       T00885                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:avn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3730311..3730925)
Genome map
AA seq 204 aa AA seqDB search
MRILIGRLRGILVEKQPPHLLVEANGVGYEVEVPMTTLYRLPSLNEPVTLHTHLVVREDA
HLLYGFCERRERELFRELIRLNGVGPKLALALMSSLELDELVRCVQAGDIKALTRVPGVG
KKTAERLLIELKDRFKAWESLPTVASLTLESNPDIGIASAESDALSALVALGFKPQEASR
AVAAVQEEGLSSEELIRRALRGMA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgcggatcttgatcggacgtttgcgcggtatcctggtggaaaagcagccgccgcacctg
ctcgtggaggccaatggcgtcggctacgaggtcgaggtgccgatgaccaccctctatcgc
ctgccgtcgctgaacgagccggttaccttgcacacccacctggtggtgcgcgaggatgcc
cacctgctctacggtttctgcgaaaggcgcgagcgggaactgtttcgcgagctgatccgc
ctcaacggggtcggccccaagctggcgctggcgctgatgtccagcctggagctggacgag
ctggtgcgctgcgtgcaggctggcgatatcaaggcgctgacccgggtgcccggggtcggc
aagaagaccgccgagcgcctgctgatcgagctgaaggaccgcttcaaggcttgggaaagt
ctgccgaccgtcgcctcgctgaccctggagtccaatcccgatatcggcatcgccagcgcg
gaaagcgatgccttgagcgcgctggtcgccctcggcttcaagccccaggaggccagccgc
gcggtcgccgccgtacaggaggaaggtttgagcagcgaggagctgattcgccgggcattg
cgggggatggcctaa

DBGET integrated database retrieval system