KEGG   Azotobacter vinelandii DJ: Avin_39150Help
Entry
Avin_39150        CDS       T00885                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:avn01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:avn00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3967980..3969170
Genome map
AA seq 396 aa AA seqDB search
MPSFSRRFGAMMTATALSPTLALACELIDRPSVTPLDEGCQALMMARLGALGFALEPMRI
GEVENFWARRDGGTGEGPVLCFAGHTDVVPTGPHEAWQTPPFTATLDADGMLRGRGAADM
KGSLAAMLVAVERFVADHPRHRGAIAFLITSDEEGPALHGTQAVVERLRARGERLDWCIV
GEPSSSETLGDVVKNGRRGSLGATLTVRGKQGHVAYPQLARNPIHQAAPALAELAAEHWD
DGNAFFPPTSFQISNIQAGTGATNVIPGELQMLFNFRFSTESTVEGLQRRVAAILDRHGL
DWHIDWALSGLPFLTEPGALLDAVSASIRAVTGRDTTPSTSGGTSDGRFIATLGTQVVEV
GPLNATIHQVDECVLASDLELLTEIHYQTLVRLLAC
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccttttcccgccgtttcggagccatgatgaccgccaccgccctctcccccacc
ctggcgctcgcctgcgaactgatcgaccggccctcggtcacgccgctggacgagggttgc
caggcgctgatgatggcccgcctgggcgccctcggcttcgccctggaaccgatgcgcatc
ggagaggtggagaatttctgggcccgtcgcgacggcggcacgggcgagggaccggtactc
tgcttcgccggccataccgacgtggtgccgacaggtccgcacgaagcttggcagaccccg
cccttcaccgccaccctcgacgccgacggcatgctccgcgggcgcggcgcggcggacatg
aagggcagcctggcggccatgctggtcgcggtggaacgcttcgtcgccgaccatccgcgc
catcgcggggcgatcgccttcctgatcaccagcgacgaggaaggcccggcgctgcacggt
acccaggcggtggtcgagcgcctgcgcgcgcgtggcgaacgcctggactggtgcatcgtc
ggcgagccgtcgagcagcgagacgctcggcgacgtggtgaagaacggccggcgcggctcg
ctcggcgcgactctgacggtgcgcggcaagcagggccacgtggcctatccgcaactggcc
aggaatcccatccaccaggccgcgccggcgctggccgaactggccgccgagcactgggac
gacggcaacgccttcttcccgccgaccagcttccagatctccaacatccaggccggcacc
ggcgccaccaacgtgatccccggcgagctgcagatgttgttcaacttccgcttctccacc
gagtccacggtggagggtctgcagcggcgcgtcgcggcgatcctcgaccgccacggcctc
gactggcacatcgactgggcgctgtccggcctgcccttcctcaccgaaccgggcgcactg
ctggacgccgtgtcggccagcatccgcgcggtgaccggccgggacaccacgccctcgacc
agcggcggcacctcggacggccgcttcatcgccaccctgggcacccaggtggtcgaggtc
ggtccgctcaacgccaccatccaccaggtcgacgaatgcgtgctggccagcgacctggag
ctgctcaccgaaatccactaccagaccctggtgcggctgctggcatgctga

DBGET integrated database retrieval system