KEGG   Azotobacter vinelandii DJ: Avin_40760Help
Entry
Avin_40760        CDS       T00885                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:avn01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:avn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4113637..4114743)
Genome map
AA seq 368 aa AA seqDB search
MTGARRWVVKIGSALLTADGRGLDRSSMAVWVEQMVVLREAGVELVLVSSGAVAAGMSQL
GWSARPKAIHELQAAAAVGQMGLVRAWESSFAEHSRHTAQILLTHDDLSDRKRYLNARST
LRTLLDLGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFDADPR
NNPDARLIFEARADDPRLDGAAGSSGGALGRGGMQTKLRAARLAARSGAHTVIIGGRIER
VLDRLKAGERLGTLLAPEQGMLAARKQWLAGHLQMRGTLVLDAGAVAALTHHHRSLLPVG
VKSVVGNFRRGEMVVCVDREGREIARGLVNYSSAEAQKIVGHPSEQIEQLLGYVDEPELV
HRDNLILV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggtgcgcggcgttgggtggtgaagatcggcagtgccttgctgaccgccgacggt
cgtggcctggaccgttcttcgatggcggtctgggtcgagcagatggtggtgctgcgcgag
gccggcgtggagctggtgctggtgtcttccggcgctgtggccgccggcatgagccaactg
ggctggagcgcccgcccgaaggccatccacgagttgcaggcggcggccgcagtggggcag
atggggctggtgcgggcctgggagtcgagtttcgccgagcacagccggcataccgcgcag
atcctgctgacccatgacgacctctccgaccgcaagcgctacctgaacgcccgcagtacc
ctgcgcaccctgctggatctcggtgtcgttccggtgatcaacgagaacgacaccgtggtc
accgacgagatccgcttcggcgacaacgataccctggcggcgctggtggccaacctggtg
gaggcggacctgttggtcatcctcaccgaccgcgacggcatgttcgatgccgatccgcgc
aacaatcccgatgccaggttgatcttcgaggcgcgcgccgacgacccgcgcctggacggc
gccgccggctccagcggtggcgccctcggccgcggcggcatgcagaccaagctgcgcgcg
gcgcggctggcggcccgttccggggcccatacggtgatcatcggcgggcgcatcgagcgg
gtgctggatcggctcaaggccggcgagcggctgggcaccctgctggcgcccgagcagggc
atgctggcggcacgcaagcaatggctggccgggcatctgcaaatgcgcggcaccctggtg
ctggatgccggggcggtagcggcgctgacccaccatcaccgcagcctgctaccggtgggg
gtgaagtcggtggtggggaatttccgccgcggcgagatggtggtttgcgtcgatcgagag
gggcgcgagatagcccgtggcctggtgaactacagttccgccgaggcgcagaagatcgtc
ggtcatccgtccgagcagatcgagcagttgctgggttatgtcgacgagccggaactggtg
catcgcgacaatctgattctggtttga

DBGET integrated database retrieval system