KEGG   Azotobacter vinelandii DJ: Avin_41510Help
Entry
Avin_41510        CDS       T00885                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Avin_41510 (ipk)
Enzymes [BR:avn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Avin_41510 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4185633..4186499
Genome map
AA seq 288 aa AA seqDB search
MRHAQLILPAPAKLNLMLHILGRRADGYHELQTLFQFLDHGDELGFAVREDGAIRLHTEI
PGVPHDGNLIVRAARQLQRQSGCRLGADIWLDKRLPMGGGIGGGSSDAATTLLGLDRLWG
LGWDEERLAALGLALGADVPVFVRGRAAFAEGVGERLRPVELEEPWFLVVAPQVTVSTAE
IFADPELTRNTPAITVRSLLAGEGRNDCQAVVERRYPEVRNALNWLNKFVPARMTGTGAC
VFGSFPNRGDADKVARQLPVTMPGFVAQGRNISMLHRRLETLVQGVNA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatgcacaactgatcctgccggcaccggccaagctcaacctgatgctgcacatc
ctcggtcgccgcgccgacggctaccacgagttgcagaccctgttccaattcctcgaccac
ggcgacgaactgggcttcgccgtgcgcgaggacggcgcgatccgcctgcatacggagatc
cccggcgtgccccacgacggcaacctgatcgtccgcgccgcccgccagttgcagcggcaa
agcggctgccggctgggcgccgacatctggctggacaagcgcctgccgatgggcggcggc
atcggtggcggcagttcggacgcggcgaccaccctgctcggcctcgaccgcctctgggga
ctgggttgggacgaggaacgcctggccgcgctgggtctcgccctgggcgccgatgtgccg
gtcttcgtgcgcggccgcgccgcgttcgccgaaggggtcggcgaacgcctgcgaccggtc
gagctggaggaaccctggttcctcgtcgtggcaccgcaagtcactgtcagcacagcagaa
atttttgccgacccggagttgacacgtaatacaccggccattacagttcgcagcctcctt
gcaggggaaggtcgtaacgactgccaggcagtcgtcgaaaggcgttatccggaagtacgt
aacgccttgaactggctgaacaaattcgttccggccagaatgaccggaactggggcttgc
gtatttgggagcttcccaaatcggggcgatgctgataaagtcgcccgccaacttccagtg
accatgccgggtttcgtcgcccaggggcgcaacatatcgatgttgcaccgcaggctagag
acgctggtgcagggagtgaatgcctag

DBGET integrated database retrieval system