KEGG   Azotobacter vinelandii DJ: Avin_42700Help
Entry
Avin_42700        CDS       T00885                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:avn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4305167..4305655
Genome map
AA seq 162 aa AA seqDB search
MERVYIGLGSNLADPAMQLCVALDALRTLPGTRLVAVSAFYDSDPLGPADQPYYVNAVAA
LDSALAPLELLDALQAIERKQGRVRKAERWGPRTLDLDILLFGNRQLHEKRLTVPHYHLH
ARPFVLYPLAEIAPGLRLPDGRPLDELLAACPAQGLRRRSES
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgtctatataggcctgggcagcaacctggccgaccccgccatgcagttgtgc
gtcgccctcgacgccctgcggaccctgccaggcacacgcctggtggcggtttccgccttc
tacgacagcgatcccctgggacccgccgaccagccgtactatgtgaatgccgtcgccgcg
ctggactccgcattggcccccctggaactgctcgatgccctgcaggcgatcgagcggaaa
cagggccgggtacgcaaggccgaacgctggggcccgcgcaccctggacctggatatcctg
ctgttcggcaaccgccaattgcacgaaaaacgcctgaccgtcccccactaccatctccac
gcgcgccccttcgtgctctatccactggccgagatcgcccccgggctgcgcctgccggac
ggccgcccgctcgacgaactgctcgccgcctgtccggcgcaaggactgcgccgtcgtagc
gaatcatga

DBGET integrated database retrieval system