KEGG   Azotobacter vinelandii DJ: Avin_43290Help
Entry
Avin_43290        CDS       T00885                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00620  Pyruvate metabolism
avn00630  Glyoxylate and dicarboxylate metabolism
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Avin_43290 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    Avin_43290 (glcB)
Enzymes [BR:avn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Avin_43290 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACO80450
UniProt: C1DFQ4
Position
complement(4369897..4372074)
Genome map
AA seq 725 aa AA seqDB search
MTERVQCQRLQVASQFKRFIDEEVLPGTGIDATAFWSGLDDLVHDLAPQNRALLAERDRL
QGELDAWHRANPGPIADMAAYRHFLESIGYLLPQPDEVKIATANVDDEVAVQAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDAIGEEGGAEKSSAYNAVRGARVIAFARAFLDRAA
PLANGSHADATAYAVERGALRVTLKDGSHSGLAQAEKFVGYQGAAEAPGAVLLKNHGLHI
EIQIDPDSLIGKSDAAGVKDLLLESALTTIMDCEDSVAAVDADDKVLVYRNWLGLMKGDL
SEELDKGGRRIVRRLAPDRLYQAAGGGELRLHGRALLFVRNVGHLMTTPAILDGEGREIP
EGILDAAITSLIALHDLERRGNSRTGSVYIVKPKMHGPAEVAFADRLFGRVEDLLGLPRH
TLKMGIMDEERRTSVNLKACIAAAGARIAFINTGFLDRTGDEMHTTMEAGAMLRKEDMKS
SAWIQAYERNNVLVGLSCGLRGRAQIGKGMWAIPDRMAAMLEQKIAHPKAGANTAWVPSP
TAATLHALHYHQVDVQAVQRELERIDPAAERDALLDGLLSVPVSAERAWSAEAIEEELAN
NCQGILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGVVGAEQVRE
ALRRMARVVDAQNAGDPAYRPMARDFDKSHAFGAASDLVFKGREQPSGYTEPLLHAWRRR
FKQER
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgtgtgcagtgccagcgcttgcaggtggcaagccagttcaagcgtttcatc
gacgaggaagtgctccccggcaccggcatcgacgccacggccttctggagcggcctggac
gacctggtgcacgacctggcgccgcagaaccgggccctgctggccgaacgcgaccgcctg
cagggcgagttggacgcctggcaccgggccaaccccggcccgatcgccgacatggcggcc
taccgccacttcctggagagcatcggctacctgctgccgcagcccgacgaggtgaagatc
gccaccgccaacgtcgacgacgaagtcgccgtgcaggcgggcccgcaactggtggtgccg
gtgatgaacgcgcgctatgcgctgaacgccgccaatgcccgctggggctcgctgtacgat
gccctgtacggcaccgacgccatcggcgaggaaggcggcgccgagaagagttcggcctac
aacgcggtgcgcggtgcccgcgtgatcgccttcgcccgcgccttcctcgaccgggccgcg
ccgctggccaacggcagccatgccgacgccacggcctacgccgtcgagcggggcgcgttg
cgggtgacgctcaaggacggcagccacagcggcctcgcccaggccgagaagttcgtcggc
taccagggcgccgccgaggcgcccggcgccgtgctgctgaagaaccacggcctgcacatc
gagatccagatcgatcccgacagcctgatcggcaagagcgatgcggccggcgtcaaggat
ctgctgctggagtccgcgctgaccaccatcatggactgcgaggactcggtggccgcggtg
gatgccgacgacaaggtgctggtctaccgcaactggctggggttgatgaagggcgacctc
agcgaggaactggacaagggcgggcggcgcatcgtccgccgcctcgccccggaccgcctg
tatcaggccgccggtggcggcgagctgcgcctgcacggccgcgccctgctgttcgtgcgc
aatgtcggccacctgatgaccaccccggcgatcctcgacggcgaaggccgggaaatcccc
gagggcatcctcgacgccgccatcaccagcctgatcgccctgcacgacctcgaacgccgg
ggcaattcgcgcaccggcagcgtctacatcgtcaagccgaagatgcacggcccggccgag
gtggccttcgccgaccgcttgttcggccgcgtcgaggatctgctcggcctgccgcgccac
accctgaagatgggcatcatggacgaggagcggcgcaccagcgtcaacctcaaggcgtgc
atcgccgccgccggcgcgcggatcgcattcatcaacacgggcttcctcgaccgcaccggc
gacgagatgcacaccaccatggaagccggcgccatgctgcgcaaggaggacatgaagtcc
agcgcctggatccaggcctacgagcgcaacaacgtgctggtcggcctgagttgcgggctg
cgtggccgcgcgcagatcggcaagggcatgtgggccatcccggaccggatggccgccatg
ctcgaacagaagatcgcccatccgaaggccggcgccaacaccgcctgggtaccgtcgccg
accgccgccaccctgcacgccctgcactaccaccaggtcgatgtccaggccgtgcagcgc
gagctggaacggatcgatccggccgccgagcgcgacgccctgctcgatggcctgctcagc
gtgccggtcagcgccgagcgcgcctggagcgccgaggccatcgaggaagaactggccaac
aactgccagggcatcctcggctacgtggtgcgctgggtggaacagggcgtcggctgctcc
aaggtgccggacatccacgacgtcggcctgatggaggaccgcgccaccctgcgcatctcc
agccagcacatcgccaactggctgcaccatggcgtggtcggcgcggagcaggtgcgcgag
gccctgcgacgcatggccagggtggtcgacgcccagaacgccggcgaccccgcctaccgg
cccatggcccgcgacttcgacaagtcgcacgccttcggcgccgccagcgatctggtgttc
aagggacgcgagcagcccagcggctataccgaaccgctgctgcacgcctggcgccggcgc
ttcaagcaggagcgatga

DBGET integrated database retrieval system