KEGG   Azotobacter vinelandii DJ: Avin_44840Help
Entry
Avin_44840        CDS       T00885                                 

Gene name
waaG
Definition
lipopolysaccharide core biosynthesis protein
Orthology
K02844  
UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC:2.4.1.-]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Avin_44840 (waaG)
Enzymes [BR:avn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     Avin_44840 (waaG)
Glycosyltransferases [BR:avn01003]
 Polysaccharide
  Bacterial polysaccharide
   Avin_44840 (waaG)
Lipopolysaccharide biosynthesis proteins [BR:avn01005]
 Core region
  Avin_44840 (waaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4539990..4541114)
Genome map
AA seq 374 aa AA seqDB search
MQLAFILYKYFPFGGLQRDFMRIALECQKRGHAIRVYSMSWEGETPPGFEVLIAPIRALF
NHRRNEKFTAWVRADLARRPVDRVVGFNKMPGLDVYYAADPCYEDKAQTLRNPLYRLWGR
YRHFAGYERAVFAPQAKTRILMISEVQQPLFVKHYGTPAERFHLLPPGISADRRAPPDAD
VIRADFRREFGLAGDDLLLVQIGSGFKTKGLDRSLKALAALPGALKKRTRLIAIGQDDPR
PFQLQIKALGLSGRVEILKGRSDIPRFLLGADLLIHPAYNENTGTVLLEALVAGLPVLVT
DVCGYAHYIAEAGCGQVLPSPFEQERLNRTLAAMLEDDGQRALYRRNGLAYAGTADLYSM
PQRAADLILTEQGA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcagctggccttcatcctctacaagtactttcccttcggcgggctgcagcgcgacttc
atgcgcatcgccctggaatgccagaagcgcggacacgccatccgtgtctacagcatgtcc
tgggagggcgagaccccgccgggcttcgaggtgctgatcgcgccgatcagggcgttgttc
aaccaccgccgcaacgagaagttcaccgcctgggtgcgggccgacctggcgcggcgtccc
gtggaccgggtggtcggcttcaacaagatgcccgggctggacgtctactacgccgccgac
ccctgctacgaggacaaggcgcagaccctgcgcaacccgctctatcgcctgtgggggcgc
taccggcatttcgccggctacgagcgcgcggtgttcgcgccgcaggcgaagacacgcata
ttgatgatctccgaagtgcagcaaccattgttcgtcaagcattacggcacgccggcggag
cgtttccacctgctgcctccgggcatctccgccgaccgccgcgcgccgcccgatgcggac
gtgatccgcgccgacttccgccgcgagttcggcctggccggggacgacctgctgctggtg
cagatcggctccggcttcaagaccaaggggctggaccgcagcctcaaggcgctcgccgcg
ctgcccggcgccctgaagaagcgcacccggctgatcgccatcggccaggacgatccgcgc
cccttccagttgcagatcaaggcgctcggcctgtccgggcgggtcgagattctcaagggg
cgcagcgacatcccgcgctttctgctcggcgccgatctgctgatccacccggcctacaac
gagaacaccggtaccgtgctgctcgaggcgctggtcgccggactgccggtgctggtcacc
gatgtctgcggctatgcccactacatcgccgaggcgggttgcgggcaggtgctgcccagc
cccttcgagcaggagcgcctgaaccggacgctcgccgcgatgctcgaagacgatgggcag
cgagcgctctatcggcgcaacggcctggcctacgccggaaccgccgacctctattccatg
ccgcagcgggccgccgatctgatcctgacggagcagggcgcgtga

DBGET integrated database retrieval system