KEGG   Azotobacter vinelandii DJ: Avin_45710Help
Entry
Avin_45710        CDS       T00885                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Avin_45710 (glpK)
Enzymes [BR:avn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Avin_45710 (glpK)
Exosome [BR:avn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Avin_45710 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4639408..4640925
Genome map
AA seq 505 aa AA seqDB search
MTQTNNKHYIVALDQGTTSSRAIVLDRDANVVSVAQHEFTQIYPQSGWVEHDPMEIWATQ
SATLVEALAQAGIDHRQVAAIGITNQRETTVIWDKQSGRPIHNAIVWQCRRSAAICEELK
RDSLEEHVRERTGLVIDPYFSATKIKWVLDHVEGSRERARRGELLFGTVDSWLIWKMTQG
RVHVTDFTNAARTMLFDIHALDWDARLLEALDIPREMLPQVRSSSEVYGHACIAGGDEDD
GIPIAGIAGDQQAALFGHMCVEPGQGKNTYGTGCFLLMNTGAKAVRSGHGLLTTIACGPR
GEVAYALEGAIFNAGSTVQWLRDELKLIDDSFDSEYFATKVQDSNGVYLVPAFTGLGAPY
WDPYARGAVFGLTRGVKADHLIRAALESIAYQTCDVLDAMQRDAGERLKALRVDGGAVSN
NFLMQFQADLLGTPVERPAVKEVTALGAAYLAGLATGFWSGLDELRDKARIERVFEPACS
EEKRRSLSAGWKKAVLRSQRWAEDD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccaacaacaagcactacatcgtcgccctggaccaaggcaccaccagttcc
cgggccatcgtgctcgaccgcgacgccaacgtcgtcagcgtggctcagcacgagttcacc
cagatctatccgcaatcgggctgggtcgagcacgatcccatggagatctgggccacgcag
agcgccaccctggtggaggccctggcccaggccggcatcgaccaccggcaggtggccgcc
atcggcatcaccaaccagcgcgaaaccacggtgatctgggacaaacagagcggccggccg
atccacaacgccatcgtctggcaatgccgacgcagtgccgcgatctgcgaggaactcaaa
cgcgacagcctggaggaacatgtcagggaacgtaccggcctggtcatcgatccctatttc
tccgcaaccaaaatcaaatgggtcctcgaccacgtcgagggcagccgcgagcgtgcgcgg
cgcggcgaattgctgttcggcaccgtcgactcctggctgatctggaagatgacccagggc
cgggtgcacgtcaccgacttcaccaacgccgcgcgcaccatgctcttcgacatccacgcg
ctggactgggatgcgcgcctgctcgaggccctcgacatcccgcgcgagatgctgccgcag
gtgaggtcgtcctccgaggtctacggccatgcctgcatcgccggcggcgacgaggacgac
ggcatcccgatcgccggcatcgccggggaccagcaggccgcgctcttcggccacatgtgc
gtggagcccggccagggcaagaacacctacggcaccggctgcttcctgctgatgaacact
ggcgccaaggccgtgcgctcgggccacgggctgctcaccaccatcgcctgcgggccgcgc
ggggaggtcgcctacgcgctggaaggggcgatcttcaatgccggctccacggtgcagtgg
ctgcgcgacgagctcaagctgatcgacgattcgttcgattccgaatatttcgccaccaag
gtccaggacagcaacggcgtctacctggtaccggccttcaccggcctgggcgcaccctac
tgggacccctacgcgcgcggcgcggtgttcggcctgacccgcggcgtgaaggccgaccac
ctgatccgcgccgcgctcgaatccatcgcctaccagacctgcgacgtgctcgacgccatg
cagcgggacgccggcgagcgcctcaaggcgttgcgcgtggatggcggcgcggtgagcaac
aacttcctcatgcagttccaggccgatctgctcggcacgccagtcgagcgtccggcggtg
aaggaagtcaccgcgctcggcgccgcttacctggcaggcctggccaccggattctggagc
ggcctcgacgaactgcgcgacaaggcgcggatcgagcgggtgttcgagccggcctgctcc
gaagagaaacgccgctcgctgagtgccggctggaagaaggcggtgctgcgcagccagcgc
tgggccgaggacgactag

DBGET integrated database retrieval system