KEGG   Azotobacter vinelandii DJ: Avin_45770Help
Entry
Avin_45770        CDS       T00885                                 

Gene name
tpiA-2
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00010  Glycolysis / Gluconeogenesis
avn00051  Fructose and mannose metabolism
avn00562  Inositol phosphate metabolism
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
avn01200  Carbon metabolism
avn01230  Biosynthesis of amino acids
Module
avn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
avn_M00002  Glycolysis, core module involving three-carbon compounds
avn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_45770 (tpiA-2)
   00051 Fructose and mannose metabolism
    Avin_45770 (tpiA-2)
   00562 Inositol phosphate metabolism
    Avin_45770 (tpiA-2)
Enzymes [BR:avn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Avin_45770 (tpiA-2)
Exosome [BR:avn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Avin_45770 (tpiA-2)
  Exosomal proteins of bladder cancer cells
   Avin_45770 (tpiA-2)
  Exosomal proteins of melanoma cells
   Avin_45770 (tpiA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACO80688
UniProt: C1DHV5
Position
4645614..4646369
Genome map
AA seq 251 aa AA seqDB search
MKRKQVIGNWKMNGDLAANRRLLDELLPSLAALDGVELAVCPPFPYLAQVAALLEGSGVA
LGAQNLNVAAKGAFTGEVSAGMLGELGCRYVLVGHSERRSLYGECDETVAEKFAVALRAG
LVPVLCVGETLAQRRQGRTEALVSAQLQAVLRRSGIEGLAAGVIAYEPVWAIGNGETASP
EQAQAVHRHIRDLLAQHDPARGVATPILYGGSVKADNAAALFAQPDIDGGLIGGASLEAA
AFAAICQAAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaaacaggtcatcggcaactggaagatgaacggcgacctggccgccaaccgg
cgcctgctggacgaactgctgccgtcgctggcggcgctcgacggcgtcgaactggcggtc
tgtccgcccttcccctacctggcgcaggtcgccgccctgctggagggctccggcgtggcg
ctgggcgcgcagaacctcaacgtggcggcgaagggcgccttcaccggcgaagtcagcgcc
ggcatgctcggggagctgggctgccgctacgtgctggtcggccattccgagcggcgcagc
ctgtacggcgagtgcgacgagacggtggcggagaagttcgccgtggcgctcagggccggc
ctggtgccggtgctgtgcgtcggcgagaccctggcgcagcgccgccaggggcgtaccgag
gcgctggtgtccgcgcagttgcaggcggtcctgcgccgctcgggcatcgagggcctcgcc
gccggggtgatcgcctacgagccggtgtgggccatcggcaacggcgagaccgccagcccc
gagcaggcccaggcggtgcaccggcatatccgcgacctgctggcccagcacgaccccgcg
cggggcgtggccacgccgatcctctacggcggcagcgtcaaggccgacaacgccgccgcg
ctgttcgcccagccggacatcgacggcgggctgatcggcggcgcctcgctggaggcggcc
gcgttcgccgcgatctgccaggccgccgcacgctag

DBGET integrated database retrieval system