KEGG   Azotobacter vinelandii DJ: Avin_46220Help
Entry
Avin_46220        CDS       T00885                                 

Gene name
pncA
Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:avn00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4698073..4698696
Genome map
AA seq 207 aa AA seqDB search
MKRLPPIGENDLLLVIDLQNDFCAGGALTVPGADEVVPTINRLAEDFAHVALTQDWHPPG
HRSFASSHPGRRPFESVRLDYGEQTLWPDHCVQNSHGAELHPALDIPHAELILRKGYRAE
VDSYSAFHENDRCTPTGLAGYLRERGLRRLFLAGLATDYCVHYTALDARLAGFETLLLAQ
ACRAIDRDGSLAAALQAMRAAGVKILD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctgccgcccatcggcgagaacgacctgctgctggtgatcgacctgcagaac
gatttctgcgccggcggcgccctgaccgtgccgggcgccgacgaagtggtgccgacgatc
aaccgcctggccgaagacttcgcccacgtggcgctgacccaggactggcacccgccgggc
caccggagcttcgccagcagccatccggggcgccggccgttcgagagcgtccggctggac
tacggcgagcagaccctgtggcccgaccactgcgtgcagaacagccacggcgccgaactc
caccccgcgctggacatcccccatgccgagctgatcctgcgcaaaggctaccgcgccgag
gtcgactcctactcggcgttccacgagaacgaccgctgcacgcccaccggcctggccggc
tacctgcgtgaacggggcctgcgccggctgttcctcgccggcctggccaccgactactgc
gtgcactacaccgcgctggacgcgcgcctggcgggcttcgagacgctgctgctggcgcag
gcctgccgcgccatcgaccgcgacggctccctcgccgcggcgctgcaggcgatgcgcgcg
gccggggtgaagatcctcgactag

DBGET integrated database retrieval system