KEGG   Azotobacter vinelandii DJ: Avin_46670Help
Entry
Avin_46670        CDS       T00885                                 

Gene name
gabT
Definition
4-aminobutyrate transaminase
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Avin_46670 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Avin_46670 (gabT)
   00310 Lysine degradation
    Avin_46670 (gabT)
Enzymes [BR:avn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Avin_46670 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     Avin_46670 (gabT)
Amino acid related enzymes [BR:avn01007]
 Aminotransferase (transaminase)
  Class III
   Avin_46670 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4736247..4737527)
Genome map
AA seq 426 aa AA seqDB search
MSRTNESLMQRRIAAVPRGVGQIHPIFAEHARNCSVVDVEGREYIDFAGGIAVLNTGHLH
PKVVEAVQRQLHKLSHTCFQVLAYEPYVELCEKLNARVPGDFAKKTLLVSTGSEAVENAV
KIARAATGRTGVIAFTSAYHGRTLMTLALTGKKVPYAAGMGLLPGGVFRARYPSALHGID
VAEALASVERVFKNDAEPRDIAAILVEPVQGEGGFNVAPPEFMRGLRAICDRHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTAFAKSIAGGFPLAGVCGRAEPMDAIAPGGLGGTYA
GSPLACAAALAVLEVFEEERLLERARDIGARLSEGLRAIQGRHPSIVEVRGLGAMVAMEL
CEGGDPHKPATALTGQLVVRARDKGLILLSCGAYGNVLRFLMPLTVPDELLERGLAILAE
CFDELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggaccaacgaatccctgatgcaacgccggatcgccgcggtgccgcgcggcgtc
gggcagatccacccgatcttcgccgagcatgcgcgcaactgcagcgtggtcgacgtggag
gggcgcgagtacatcgacttcgccggcggcatcgccgtgctcaacaccggccacctgcac
ccgaaggtcgtcgaggcggtgcagcggcaattgcacaagctgtcgcacacctgcttccag
gtgctggcctacgagccctacgtcgagctctgcgaaaagctcaacgcgcgcgtgccgggc
gacttcgccaagaagaccctgctggtcagcaccggctcggaggcggtggagaacgccgtg
aaaatcgcccgcgccgccaccgggcggaccggggtgatcgccttcaccagcgcctatcac
gggcgcaccctgatgaccctggcgctgaccggcaagaaggtgccctacgccgccggcatg
ggccttctgcccggcggcgtgttccgcgcccgctaccccagcgcattgcacggcatcgac
gtggccgaggcgctggccagcgtcgagcgggtgttcaagaacgacgccgagccgcgcgat
atcgccgcgatcctggtcgagccggtgcagggtgagggtggcttcaatgtcgccccgccg
gagttcatgcgcggcctgcgggcgatctgcgaccgccacggcatcctcctgatcgccgac
gaggtacagaccggcgccggacgcaccggcaccttcttcgccatggagcagatgggcgtg
gccgccgacctcaccgccttcgccaagtccatcgccggcggttttccgctggccggcgtg
tgcggccgggccgagcccatggacgccatcgctcccggcgggctcggcggcacctatgcc
ggcagcccgctggcctgtgccgcggccctggcggtgctggaggtgttcgaggaagagcgc
ctgctggagcgcgcccgggacatcggcgcgcggctgagcgaagggctgcgggcgatccag
gggcgtcatccgtcgatcgtcgaggtacgcggtctcggcgccatggtcgccatggagctg
tgcgagggcggcgatccgcacaagccggccaccgcgctgaccggacaactcgtcgtccgg
gcgcgggacaaggggctgatcctgctgtcctgcggcgcctacggcaacgtgctgcgtttc
ctgatgcccctgaccgtcccggacgaactgctcgaacgcggcctggcgattctcgccgag
tgcttcgacgaactggcctga

DBGET integrated database retrieval system