KEGG   Azotobacter vinelandii DJ: Avin_47590Help
Entry
Avin_47590        CDS       T00885                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:avn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4832966..4833754)
Genome map
AA seq 262 aa AA seqDB search
MTVRSDAGGWRLLLTRPAEECAVLADCLSEAGICSSSLPLLAIEPLAEAPELRSLFLDLD
RYSAVIVVSKPAARLGLELLDRYWPQPPADQCWFGVGRATGEILADYGLTVAWPTAGEDS
EALLALPGLATALAVPQPRVLILRGEGGREFIAESLRSRGLAVDHVELYRRTLPDYPPGT
LLERVRTERLNGLQISSGQGFEHLRQLAAADWPALLRIPLFVPSPRVAELARAAGFRTVV
DCHGASATALLAALQGRPAPTF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtacggtcggacgccggcgggtggcgcctgctgctcacccgtccggccgaggaa
tgcgccgttctggccgattgcctgagcgaggcgggcatctgcagcagcagcctgccgctg
ctggccatcgagccgctggcggaagccccggaactgcgcagcctctttctcgatctcgac
cgctacagcgcggtgatcgtggtcagcaagcccgccgctcgcctggggctggagctgctc
gaccgctactggccgcagccgccggccgatcaatgctggttcggcgtcggccgggcgacc
ggcgagatcctcgccgattacggcctgacggtcgcctggccgaccgccggcgaggacagc
gaggcgctgctggcgctgcccggactggccacggcattggccgtaccccagccgcgggtg
ctgatcctgcgcggggagggcggtcgcgagttcatcgccgaatcgttgcgcagtcggggg
ctggccgtcgatcatgtcgaactctaccggcgaaccctgccggactacccgcccggcacc
ctgctcgagcgggtccgcacggagcgcctgaacggcctgcagatcagcagcgggcaggga
ttcgagcatctgcgccaactggcggcggctgactggccggcactgcttcggatacccttg
ttcgtgccgagcccgcgggtcgccgaactggcccgcgcggcgggattccggaccgtcgtg
gactgccatggcgccagtgccactgccttgctggccgcgcttcagggccgcccagcgccg
accttttga

DBGET integrated database retrieval system