KEGG   Azotobacter vinelandii DJ: Avin_48110Help
Entry
Avin_48110        CDS       T00885                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00670  One carbon pool by folate
avn00790  Folate biosynthesis
avn01100  Metabolic pathways
Module
avn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Avin_48110
   00670 One carbon pool by folate
    Avin_48110
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Avin_48110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ACO80915
UniProt: C1DK10
Position
complement(4875775..4876290)
Genome map
AA seq 171 aa AA seqDB search
MNESRLPLALIAAVAANGAIGRDNRLPWHLPADLRHFKASTLGKPVIMGRKTWDSLGRPL
PGRLNLVVSRQPGLVLEGAETFASLDAALTRADTWAREQGAGELMLIGGAQLYVESLPRA
ERLYLTRVDLAPQGDAFFPAWNPADWRLVSREEHPATAQAPGYAFELWERG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatcccggctccctctcgccctgatcgccgccgtcgccgccaatggtgcgatc
ggtcgcgacaaccgcctgccctggcacctgccggcggacctcaggcacttcaaggcttcc
accctcggcaagccggtcatcatgggccgcaagacctgggactccctcggccgtccgttg
cccggccggctcaacctggtggtcagccgccagcccggcctcgttctggaaggcgccgaa
accttcgcctcgctcgatgccgccctgacccgcgccgatacctgggcccgggagcagggc
gccggcgagttgatgctgatcggcggcgcgcagctttatgtcgaaagcctgccgcgggcc
gaacgcctttatctgacccgcgtcgacctcgccccgcagggcgatgccttctttcccgcg
tggaatcccgccgactggcgcctcgtttcccgcgaggaacatccggccacggcgcaggcg
ccagggtatgccttcgaactgtgggagcgcgggtaa

DBGET integrated database retrieval system