KEGG   Azotobacter vinelandii DJ: Avin_48620Help
Entry
Avin_48620        CDS       T00885                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_48620
Enzymes [BR:avn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Avin_48620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4925184..4926098
Genome map
AA seq 304 aa AA seqDB search
MNEPFTAPQVERIEMGELPCWRIKTAAAELLVAEQGAQVLSYQRHGEQPLIWLSEQAEFR
RGLSVRGGVPVCWPWFGDLARNPAGVRAMREDHGPAPAHGEVRGRDWRLQDIAKENGAVT
LTFDLPQSASGELPGWPHALDLTLAIRLDERLDLSLTTRNRSSYRVALSQALHTYLAVGD
IREVGIEGLDGLRYIETLEDWDERHQRGILNFAGETDRIYLDTPPRLDLVDASWKRRICL
EASGSHSAIVWNPWIDKAARLSQFADDAWQRMLCIETANVLDDAVELAPEQSATLALCLW
SEPL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacccttcacagccccccaggtcgagcggatcgaaatgggcgaactgccctgc
tggcggatcaagaccgccgcagccgaactgctggtcgccgaacagggcgcccaggtgctc
agctaccagcgccacggcgaacagccgctgatctggctcagcgagcaggcggagttccgc
cgcggcctgtcggtgcgcggcggggtgccggtctgctggccctggttcggcgacctggcg
cgcaatccggccggcgtgcgcgccatgcgcgaagaccatggcccggcgccggcccacggc
gaagtacgcggccgcgactggcggttgcaggacatcgccaaggaaaacggcgcggtgacc
ctgaccttcgacctgccgcagtcggcctccggcgaactgcccggctggccccatgcgctc
gacctgaccctggccatccgcctcgacgaacgcctcgacctcagcctgaccacccgcaac
cgcagcagctaccgggtcgccctgagccaggcgctgcacacctacctggcggtcggcgac
atccgcgaggtgggcatcgagggcctcgacggcctgcgctacatcgaaaccctggaggac
tgggacgagcgccaccagcgcggcatcctgaacttcgccggcgaaaccgaccgcatctac
ctggataccccgccgcgcctcgatctggtcgacgccagctggaagcggcggatctgcctg
gaagccagcggctcgcactcggccatcgtctggaatccctggatcgacaaggccgcccgt
ctctcgcagttcgccgacgacgcctggcagcgcatgctctgcatcgaaacggccaacgta
ctggacgacgccgtggaactggcgcccgagcaaagcgccaccctggccctctgcctgtgg
agcgaaccgctctga

DBGET integrated database retrieval system