KEGG   Azotobacter vinelandii DJ: Avin_48620Help
Entry
Avin_48620        CDS       T00885                                 

Definition
(GenBank) Aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00010  Glycolysis / Gluconeogenesis
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_48620
Enzymes [BR:avn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Avin_48620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACO80963
UniProt: C1DK58
Position
4925184..4926098
Genome map
AA seq 304 aa AA seqDB search
MNEPFTAPQVERIEMGELPCWRIKTAAAELLVAEQGAQVLSYQRHGEQPLIWLSEQAEFR
RGLSVRGGVPVCWPWFGDLARNPAGVRAMREDHGPAPAHGEVRGRDWRLQDIAKENGAVT
LTFDLPQSASGELPGWPHALDLTLAIRLDERLDLSLTTRNRSSYRVALSQALHTYLAVGD
IREVGIEGLDGLRYIETLEDWDERHQRGILNFAGETDRIYLDTPPRLDLVDASWKRRICL
EASGSHSAIVWNPWIDKAARLSQFADDAWQRMLCIETANVLDDAVELAPEQSATLALCLW
SEPL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacccttcacagccccccaggtcgagcggatcgaaatgggcgaactgccctgc
tggcggatcaagaccgccgcagccgaactgctggtcgccgaacagggcgcccaggtgctc
agctaccagcgccacggcgaacagccgctgatctggctcagcgagcaggcggagttccgc
cgcggcctgtcggtgcgcggcggggtgccggtctgctggccctggttcggcgacctggcg
cgcaatccggccggcgtgcgcgccatgcgcgaagaccatggcccggcgccggcccacggc
gaagtacgcggccgcgactggcggttgcaggacatcgccaaggaaaacggcgcggtgacc
ctgaccttcgacctgccgcagtcggcctccggcgaactgcccggctggccccatgcgctc
gacctgaccctggccatccgcctcgacgaacgcctcgacctcagcctgaccacccgcaac
cgcagcagctaccgggtcgccctgagccaggcgctgcacacctacctggcggtcggcgac
atccgcgaggtgggcatcgagggcctcgacggcctgcgctacatcgaaaccctggaggac
tgggacgagcgccaccagcgcggcatcctgaacttcgccggcgaaaccgaccgcatctac
ctggataccccgccgcgcctcgatctggtcgacgccagctggaagcggcggatctgcctg
gaagccagcggctcgcactcggccatcgtctggaatccctggatcgacaaggccgcccgt
ctctcgcagttcgccgacgacgcctggcagcgcatgctctgcatcgaaacggccaacgta
ctggacgacgccgtggaactggcgcccgagcaaagcgccaccctggccctctgcctgtgg
agcgaaccgctctga

DBGET integrated database retrieval system