KEGG   Azotobacter vinelandii DJ: Avin_49910Help
Entry
Avin_49910        CDS       T00885                                 

Gene name
tpiA-3
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Avin_49910 (tpiA-3)
   01230 Biosynthesis of amino acids
    Avin_49910 (tpiA-3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_49910 (tpiA-3)
   00051 Fructose and mannose metabolism
    Avin_49910 (tpiA-3)
   00562 Inositol phosphate metabolism
    Avin_49910 (tpiA-3)
Enzymes [BR:avn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Avin_49910 (tpiA-3)
Exosome [BR:avn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Avin_49910 (tpiA-3)
  Exosomal proteins of bladder cancer cells
   Avin_49910 (tpiA-3)
  Exosomal proteins of melanoma cells
   Avin_49910 (tpiA-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5057757..5058497)
Genome map
AA seq 246 aa AA seqDB search
MRGKLVIGNWKMNGSLDANRRLLQELLPPLAAVKGLEVAVCPPFPYLAQVGALLEGSSVA
LGAQNLHSAGQGAFTGEVGAGMLEELGCRYVLVGHSERRSLFGESDETVAEKFEAALRAG
LVPVLCVGETLAQRRDGSTEAVIAGQVRAVLQRVGGAGIAAGVIAYEPVWAIGTGETASP
EQAQAVHRHIRALLGEATATPILYGGSVKPDNAAALFAQPDIDGGLIGGASLEAASFLAI
CRAAQS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggaaaactggtcatcggcaactggaagatgaacggcagcctggacgccaaccgg
cgcctgctgcaggaactgctgccgccgctggcggcggtgaaggggctcgaggtggcggtc
tgtccgcccttcccgtacctggcgcaggtcggcgccctgctggaaggctccagcgtggcg
ctgggcgcgcagaacctccatagcgccgggcagggcgccttcaccggcgaggtcggcgcc
ggcatgctcgaggagttgggctgccgctacgtgctggtcggccattccgagcggcgcagc
ctgttcggcgagagcgacgagacggtggcggagaagttcgaggcggcgctgcgggccgga
ctggtgccggtgctgtgcgtcggcgaaaccctggcgcagcgccgcgacggcagcaccgag
gcggtcatcgccgggcaggtgcgggcggtcctgcaacgggtcggcggcgccgggatcgcc
gccggggtgatcgcctacgaaccggtgtgggccatcggcaccggcgaaaccgccagtccc
gagcaggcccaggcggtacaccggcacatccgcgcgctgctgggcgaggccaccgccacg
ccgatcctctacggcggcagcgtcaagccggacaacgccgccgcgctgttcgcccagccg
gacatcgacggcggcctgatcggcggggcctcgctggaggccgcctccttcctggcgatc
tgccgggcggcgcagtcctag

DBGET integrated database retrieval system