KEGG   Azotobacter vinelandii DJ: Avin_49960Help
Entry
Avin_49960        CDS       T00885                                 

Gene name
tpiA-1
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Avin_49960 (tpiA-1)
   01230 Biosynthesis of amino acids
    Avin_49960 (tpiA-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_49960 (tpiA-1)
   00051 Fructose and mannose metabolism
    Avin_49960 (tpiA-1)
   00562 Inositol phosphate metabolism
    Avin_49960 (tpiA-1)
Enzymes [BR:avn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Avin_49960 (tpiA-1)
Exosome [BR:avn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Avin_49960 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   Avin_49960 (tpiA-1)
  Exosomal proteins of melanoma cells
   Avin_49960 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5063506..5064261)
Genome map
AA seq 251 aa AA seqDB search
MKRKQVIGNWKMNGDLAANRRLLDELLPSLAALDGVELAVCPPFPYLAQVAALLEGSGVA
LGAQNLNVAAKGAFTGEVSAGMLGELGCRYVLVGHSERRSLYGECDETVAEKFAVALRAG
LVPVLCVGETLAQRRQGRTEALVSAQLQAVLRRSGIEGLAAGVIAYEPVWAIGNGETASP
EQAQAVHRHIRDLLAQHDPARGVATPILYGGSVKADNAAALFAQPDIDGGLIGGASLEAA
AFAAICQAAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaaacaggtcatcggcaactggaagatgaacggcgacctggccgccaaccgg
cgcctgctggacgaactgctgccgtcgctggcggcgctcgacggcgtcgaactggcggtc
tgtccgcccttcccctacctggcgcaggtcgccgccctgctggagggctccggcgtggcg
ctgggcgcgcagaacctcaacgtggcggcgaagggcgccttcaccggcgaagtcagcgcc
ggcatgctcggggagctgggctgccgctacgtgctggtcggccattccgagcggcgcagc
ctgtacggcgagtgcgacgagacggtggcggagaagttcgccgtggcgctcagggccggc
ctggtgccggtgctgtgcgtcggcgagaccctggcgcagcgccgccaggggcgtaccgag
gcgctggtgtccgcgcagttgcaggcggtcctgcgccgctcgggcatcgagggcctcgcc
gccggggtgatcgcctacgagccggtgtgggccatcggcaacggcgagaccgccagcccc
gagcaggcccaggcggtgcaccggcatatccgcgacctgctggcccagcacgaccccgcg
cggggcgtggccacgccgatcctctacggcggcagcgtcaaggccgacaacgccgccgcg
ctgttcgcccagccggacatcgacggcgggctgatcggcggcgcctcgctggaggcggcc
gcgttcgccgcgatctgccaggccgccgcacgctag

DBGET integrated database retrieval system