KEGG   Azotobacter vinelandii DJ: Avin_51410Help
Entry
Avin_51410        CDS       T00885                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Avin_51410
  Lipid metabolism
   00561 Glycerolipid metabolism
    Avin_51410
   00600 Sphingolipid metabolism
    Avin_51410
Enzymes [BR:avn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Avin_51410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5224421..5226622)
Genome map
AA seq 733 aa AA seqDB search
MTQAPITSPCIPEIETAGQGGGHPETLIRLDGTNATLLLIRRRAGLPEIAYWGRRLPQEI
SEAEIFAVRAPDSPNNGPDQWRPLITLLDTIGCWNFDMPGLIAARPDGSGWTANFETEQV
AQEGRRLVVRGKDTVSGLAIVLSLELGPDDVLTSQARLTNTGTQSLRVERLVSGTYLLPE
SVDTAHVLSGEWGNEFGIEPMNLTRGGIVVESRRNRAHDHFPGMLLSPASTSENEGEAWA
AQLGWSGGHRLCVERMEDGRIRLSCGEYLYSGEGDLAPGAELVTPVAYATYSSAGFSGCA
RAFQAHARRHLLHWPGGKMKPRPVLLNSWEGSGFDLHEDQLMRQVDAAAALGIERFVLDD
GWFGARRDCDAGLGDWFSAASVFPNGLRPLSDRIHGHGMEFGLWYEPEMVNPDSDLYRAH
PDWVLQTRGYPLWTSRNQLVLDISRPEVSNYLFEVISEQVASVRIDYIKWDFNRDLVEAS
DAQGRAAYRRQVLALYALWERLHKAHPGLEIESCASGGGRADWGALAHTQRVWTSDDTDA
LERLAIQGAAWHFLPPEVTGCHISEVPNGITGRTTTLDFRACVAIFGHLGVELDPTHLSA
EESTRLKAWIALHKRLRGLLHHGLAQFCTADPARVVRGVVSDDARSGVFLVAQRDWVSAR
RPSPIRLSGLDPAKTYRITLPEPQNLPGYRPSEAQKAVFSGKVPVSGATLMDVGVFPPFM
PPLSALVVELQAV
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagcacctatcacttctccatgcattccggaaatcgaaacggccggccaaggg
ggcggccatcctgaaacattgatccggctggatggtacgaacgctaccttattgctgatc
cgtcgccgggcggggttgccggaaatcgcgtattgggggcggcgcctgccgcaggaaatc
tcggaagccgagatcttcgccgtgcgtgccccggacagccccaataacgggccggaccag
tggcgcccgctgatcacgctgctcgatacgatcggctgctggaatttcgatatgcccggc
ctgatcgcggcgcgtcccgatggaagcggctggactgcgaatttcgagaccgagcaggtc
gcacaggagggccggcggctcgtggtacgggggaaggacaccgtatccgggcttgcgata
gtgctgagtctggaactcggacccgatgacgtgctgaccagccaggcgcggctgaccaat
accggcacgcagagcctgcgggtcgagcggcttgtctcggggacctatctgttgcccgag
tcggtcgataccgcgcatgtgctgtccggcgaatgggggaatgaattcggcatcgagccg
atgaacctgacccgtggcgggatcgtggtggagagccgccgcaaccgtgcgcacgatcac
ttccccggcatgctgctctcgccggccagcacctcggagaacgagggcgaagcctgggcc
gcacagcttggctggagcggcggtcatcgtctttgcgtggagcggatggaggacggacgc
atccgtttgtcatgcggcgaatatctctattcgggtgagggcgatctcgcgcctggcgcc
gagctggttacaccggttgcctatgccacctattcgtccgccgggttttccgggtgtgcc
cgagccttccaggcccatgcgcgtcgccaccttctgcactggccgggcggcaagatgaaa
ccgcgcccggtccttttgaactcctgggaggggagcgggttcgacctgcatgaggatcaa
ctgatgcgccaggtggacgcggcggccgcactcggcatcgaacggttcgtactggatgac
ggctggttcggggcacgacgcgattgcgatgccgggcttggcgactggttctccgccgct
tcggtttttccgaatggtctgcgtcccctgtccgacaggattcacgggcacggcatggag
ttcgggctctggtacgagccggagatggtcaatccggacagcgacctgtatcgcgcgcat
ccggactgggtgctgcagacgcgcggctaccctttgtggacgtcccgcaaccagttggtg
ctggatatttcgcggcccgaggtctcgaattacctgttcgaagtgatctccgagcaggtc
gccagcgtgcggatcgattacatcaagtgggatttcaatcgcgatctggtcgaggcatcc
gatgcgcaaggtcgcgcggcctaccgccgccaggtcctggcgctctatgcgctgtgggag
cggctgcacaaggcgcatcccggcctggagatcgaaagctgcgcatccggcggcggccgg
gctgactggggcgcgctggcacatacgcaacgcgtctggacttcggacgacaccgatgcg
ctggagcgtctcgcgatccagggcgcggcatggcatttcctgccgccggaggtgacgggc
tgccatatctcggaggttccgaatgggataaccggtcggacgacgacgctggatttccgg
gcgtgcgtggcgattttcgggcatctgggggtggaactggatccgacgcacctgtccgcc
gaggagtccacgcggctcaaggcgtggatcgcgctccacaagcggctgcgcggcctgctc
catcacgggctggcacagttctgcacggcggacccggcacgggtcgtgcgcggggtcgtc
tccgacgatgcacggtcgggggtcttcctggtagcccagcgcgactgggtttccgcccgc
aggccttcgcccatcaggctgagcggtctcgaccccgcgaaaacctatcgcatcacactc
cctgagccgcaaaacctgccagggtaccggccgtccgaggcgcaaaaagcggtattttcc
ggaaaagtcccggtcagcggagcgacattgatggatgtcggagttttcccgcctttcatg
ccgccattgtccgccctggtcgtggagttgcaggccgtataa

DBGET integrated database retrieval system