KEGG   Aeromonas veronii: B565_0024Help
Entry
B565_0024         CDS       T01462                                 

Definition
Lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
avr  Aeromonas veronii
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:avr00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(32362..33402)
Genome map
AA seq 346 aa AA seqDB search
MKPLSLSLLALTLFSAGALAVTNTYQLTSEADVPSLYQQTLPDFWRQHAVEGEFKGKDGV
TIRYAALRQAKVDRAILIVNGRVESYLKYQELAWDLWRQGYSLYLIDHRGQGMSDRMLND
PQKGYVDQFDDYVVDLKQFHDQIIMADQPAKLFLLAHSMGGAISARYLERWPDDIKAAVL
SSPMLGINLGGLPKWLAKGLASTIGTVGGWIGEPPYGPGQGAYQDHGFADNELTHSQSRY
QAFRQLYEQHPQIKLGGATAHWIYQGITGADAAIADAGAIKTPLLVLQAGSDSVVDNAAQ
ERFCTIAKCEGGKPLRIEGAWHELFIESDDKRQPALTAMVDFFARF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccctctctctttccctgttggccctgaccctgttttctgccggagcccttgcc
gtgaccaatacctatcagctcaccagcgaagccgatgtacccagcctctaccagcaaacc
ctgcccgacttctggcgccagcatgcggtggaaggagagttcaagggcaaggatggggtg
accatccgctatgccgcgctgcggcaagccaaggtcgatcgcgccatcctcatcgtcaat
ggccgagtcgaaagctacctcaagtatcaggagctggcgtgggatctctggcgtcagggc
tacagcctctatctcatcgaccatcgcggtcaggggatgtccgaccggatgctgaatgac
ccgcagaagggatatgtcgaccagttcgacgattatgtggtcgatctcaagcaatttcac
gaccagataatcatggcggaccagcctgccaagctgttcctgctggcccactccatgggc
ggcgccatctcggcccgctatctggaacgctggcccgatgatatcaaggcggccgtgctc
tcttcccctatgctgggcatcaatctcggcggtctgcccaagtggctggccaagggattg
gcgagcaccataggcacggtcggcggctggattggcgaacctccctacggcccaggtcag
ggcgcctatcaggatcacggctttgccgataacgagctgactcacagccagtcccgctat
caggcgttccgccagctctacgaacagcacccgcagatcaagctgggtggcgcgaccgcc
cactggatttatcaggggatcactggtgccgatgctgccatcgccgatgcaggcgccatc
aaaaccccgctgctggtgctgcaggctggcagcgacagcgtggtggacaatgccgcgcag
gaacgcttctgcaccattgccaagtgcgaaggtggcaaaccactgcgcatagaaggtgcc
tggcacgagctgtttattgaatccgatgacaagcgccagcccgccctgaccgcgatggtc
gactttttcgcccgcttctga

DBGET integrated database retrieval system