KEGG   Aeromonas veronii: B565_0024Help
Entry
B565_0024         CDS       T01462                                 

Definition
Lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
avr  Aeromonas veronii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    B565_0024
Enzymes [BR:avr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     B565_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(32362..33402)
Genome map
AA seq 346 aa AA seqDB search
MKPLSLSLLALTLFSAGALAVTNTYQLTSEADVPSLYQQTLPDFWRQHAVEGEFKGKDGV
TIRYAALRQAKVDRAILIVNGRVESYLKYQELAWDLWRQGYSLYLIDHRGQGMSDRMLND
PQKGYVDQFDDYVVDLKQFHDQIIMADQPAKLFLLAHSMGGAISARYLERWPDDIKAAVL
SSPMLGINLGGLPKWLAKGLASTIGTVGGWIGEPPYGPGQGAYQDHGFADNELTHSQSRY
QAFRQLYEQHPQIKLGGATAHWIYQGITGADAAIADAGAIKTPLLVLQAGSDSVVDNAAQ
ERFCTIAKCEGGKPLRIEGAWHELFIESDDKRQPALTAMVDFFARF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccctctctctttccctgttggccctgaccctgttttctgccggagcccttgcc
gtgaccaatacctatcagctcaccagcgaagccgatgtacccagcctctaccagcaaacc
ctgcccgacttctggcgccagcatgcggtggaaggagagttcaagggcaaggatggggtg
accatccgctatgccgcgctgcggcaagccaaggtcgatcgcgccatcctcatcgtcaat
ggccgagtcgaaagctacctcaagtatcaggagctggcgtgggatctctggcgtcagggc
tacagcctctatctcatcgaccatcgcggtcaggggatgtccgaccggatgctgaatgac
ccgcagaagggatatgtcgaccagttcgacgattatgtggtcgatctcaagcaatttcac
gaccagataatcatggcggaccagcctgccaagctgttcctgctggcccactccatgggc
ggcgccatctcggcccgctatctggaacgctggcccgatgatatcaaggcggccgtgctc
tcttcccctatgctgggcatcaatctcggcggtctgcccaagtggctggccaagggattg
gcgagcaccataggcacggtcggcggctggattggcgaacctccctacggcccaggtcag
ggcgcctatcaggatcacggctttgccgataacgagctgactcacagccagtcccgctat
caggcgttccgccagctctacgaacagcacccgcagatcaagctgggtggcgcgaccgcc
cactggatttatcaggggatcactggtgccgatgctgccatcgccgatgcaggcgccatc
aaaaccccgctgctggtgctgcaggctggcagcgacagcgtggtggacaatgccgcgcag
gaacgcttctgcaccattgccaagtgcgaaggtggcaaaccactgcgcatagaaggtgcc
tggcacgagctgtttattgaatccgatgacaagcgccagcccgccctgaccgcgatggtc
gactttttcgcccgcttctga

DBGET integrated database retrieval system