KEGG   Aeromonas veronii: B565_0029Help
Entry
B565_0029         CDS       T01462                                 

Definition
Guanylate kinase family
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
avr  Aeromonas veronii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:avr00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37441..38067)
Genome map
AA seq 208 aa AA seqDB search
MAQQGTLYIISSPSGAGKSSLLNALLTQHNAAGKMQLSVSHTTRATRPGEEHGVHYHFVQ
VEEFKALIERGDFLEWAEVFGNYYGTSRAAIEACLAKGIDVFLDIDWQGARQIRKQMPTK
SIFILPPSREELERRLIGRGQDSAEVIAGRMAKAIAEMVHYDEYDYVIINEDFEQALFQL
RSIIECQRLEMRHQQQAQKNLLQQLLAE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacaaggcactctctatatcatctcttctccgagcggcgctggtaaatccagt
ctgctcaatgccttgctgacccaacataacgctgcgggcaagatgcagctgtcggtttcc
cacaccacgcgcgccacccgcccgggcgaagagcacggcgtccactaccacttcgtccag
gtggaagagttcaaggcgctgatcgagcgcggtgattttctggagtgggccgaagtgttc
ggcaactactatggcacctcccgcgccgccatcgaagcctgtctggccaaggggatcgac
gtattcctcgacatcgactggcagggtgctcgccagatccgcaagcagatgccgaccaaa
tccattttcatcctgccccccagccgcgaagagctggaacgccgcctgattgggcgcggt
caggacagcgccgaagtgattgccggccgaatggcgaaagccattgccgaaatggtgcac
tacgacgagtatgactatgtcattatcaatgaagacttcgagcaggcgctgttccagctc
aggtccattattgagtgccaacggctggagatgcgtcaccagcaacaagctcaaaaaaac
ttgctgcaacagctactggcagagtaa

DBGET integrated database retrieval system