KEGG   Aeromonas veronii B565: B565_0029Help
Entry
B565_0029         CDS       T01462                                 

Definition
(GenBank) Guanylate kinase family
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
avr  Aeromonas veronii B565
Pathway
avr00230  Purine metabolism
avr01100  Metabolic pathways
Module
avr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B565_0029
Enzymes [BR:avr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     B565_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin ABC_tran AAA_16 RsgA_GTPase AAA_22 AAA_33 MMR_HSR1 AAA_35 AAA_30 AAA_29 cobW AAA_23 Dynamin_N Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: AEB48064
Position
complement(37441..38067)
Genome map
AA seq 208 aa AA seqDB search
MAQQGTLYIISSPSGAGKSSLLNALLTQHNAAGKMQLSVSHTTRATRPGEEHGVHYHFVQ
VEEFKALIERGDFLEWAEVFGNYYGTSRAAIEACLAKGIDVFLDIDWQGARQIRKQMPTK
SIFILPPSREELERRLIGRGQDSAEVIAGRMAKAIAEMVHYDEYDYVIINEDFEQALFQL
RSIIECQRLEMRHQQQAQKNLLQQLLAE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacaaggcactctctatatcatctcttctccgagcggcgctggtaaatccagt
ctgctcaatgccttgctgacccaacataacgctgcgggcaagatgcagctgtcggtttcc
cacaccacgcgcgccacccgcccgggcgaagagcacggcgtccactaccacttcgtccag
gtggaagagttcaaggcgctgatcgagcgcggtgattttctggagtgggccgaagtgttc
ggcaactactatggcacctcccgcgccgccatcgaagcctgtctggccaaggggatcgac
gtattcctcgacatcgactggcagggtgctcgccagatccgcaagcagatgccgaccaaa
tccattttcatcctgccccccagccgcgaagagctggaacgccgcctgattgggcgcggt
caggacagcgccgaagtgattgccggccgaatggcgaaagccattgccgaaatggtgcac
tacgacgagtatgactatgtcattatcaatgaagacttcgagcaggcgctgttccagctc
aggtccattattgagtgccaacggctggagatgcgtcaccagcaacaagctcaaaaaaac
ttgctgcaacagctactggcagagtaa

DBGET integrated database retrieval system