KEGG   Aeromonas veronii: B565_0221Help
Entry
B565_0221         CDS       T01462                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
avr  Aeromonas veronii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:avr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B565_0221
Enzymes [BR:avr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     B565_0221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247675..249738
Genome map
AA seq 687 aa AA seqDB search
MSGTMISTATSAMMVEQLKTLALAGRIRQLDLQFARLVADLGGSPELVLGAALTCFELGR
GHVCLPLEMLATGSLRPFGLDPQQSRDLLGDLADPARWPALFAASPLVGTEQDEGPAPRW
PLRLWHGRLYLTRYHDFELGVARHLRALSERAEWPEIAPALSRLFARDYGLVFAALLKAR
LAPDFSARHFIEKYLDLVFPSEVDWPAIEALLASAQAASDLSKLDALVPEALCCNGQKLA
AATAAARPFAVISGGPGTGKTTTVAKLLAILVETGLQAGKAPAIRLVAPTGKAAARLTES
IGSALQALDLPPEWVEAIPTEAGTLHRLLGVIPGRSQFRHHAGNPLHLDLLVVDEASMVD
LPMMARLLDALPSHARLILLGDKDQLASVEAGAVLGDICSFIEQGISPAQADWLSRQTGY
RLQGTPAGAPVRDSLCLLAKSWRFDQHSGIGQLARACNSGDATAVESVWGMGFADISLHP
WAGEAYDALIAQGVAGYGGYLKAARAGEAPAAVFKAFNSFQILCALRDGPFGVQGLNERL
ELALSRAGLIARDGDWYAGRPVMVVRNDHGVGLYNGDMGLCLPDESGRLKVWFEQPDGTL
RALLPSRLPPHETVYAMTIHKSQGSEFAHTVLVLPDSPSPLLTRELVYTGITRAKARLDL
YGDRALLAQAVRKKTERYSGLAERLGE
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaccatgatcagcaccgcgaccagcgcaatgatggttgaacagttgaaaaca
ctggcgctggctggccgcatccgccagctggatctgcaatttgccaggctggtggccgac
cttggcggcagccccgagctggtgctgggggcggcgctcacctgcttcgagctggggcgt
ggccatgtctgcctgccgctggagatgctcgctaccggatcactgcggccgttcgggctg
gatccccaacagagccgggatctgctgggggatctggcggatcctgcccgctggcccgcc
ctgtttgcggccagccccctggttggtaccgaacaggatgaggggcctgccccgcgctgg
ccgctgcggctgtggcacgggcggctctacctcacccgttaccacgactttgagctgggg
gtagcccgccatctgcgcgctttgagtgaacgcgccgaatggccggagattgctcccgcc
ctgtcgcggctgtttgcccgcgactacgggttggtgttcgcggcgctgctcaaggcccgc
ctagcccccgatttctcggcccgccactttatcgagaagtatctggatctggtgttcccc
agtgaagtggattggcccgccatcgaggcgctgctcgccagcgcccaggcggcgagcgac
ttgagcaagctggatgcgctggtgcccgaggcgctctgctgcaacggtcagaagctggcg
gcggccaccgcggcagcgcgcccctttgcggtgatctccggcggccccggcaccggcaag
accaccacggttgccaaactgctcgccattctggtggagaccggcctgcaagcgggcaag
gcaccggcgatccggctggtggctcccaccggcaaggcggcggcgcgcctcaccgagagt
atcggctctgccctgcaggctctcgatctgccccccgagtgggtcgaagcgatccccacc
gaagcgggcaccttgcaccggctgctcggggtgatcccggggcgcagccagttccgccac
cacgcgggcaacccgttgcacctcgacttgctggtggtggatgaggcatccatggttgac
ctaccgatgatggcgcgcctgctcgatgcgctgccgagccacgcccgcctgatcctgctc
ggcgacaaggatcagctcgcctcggtggaggcgggggccgtgctcggcgatatctgcagc
tttatcgaacagggcatcagcccggcgcaggcggactggctctcccgccagaccggctac
cgcttgcagggcacgcccgcaggggcaccagtgcgtgacagcctctgtttgctggccaag
agctggcgctttgatcagcattcgggcatcggccagctggcgcgcgcctgcaacagcggc
gatgccacggcggtggaatcagtctggggcatgggctttgccgatatcagcctgcacccc
tgggccggggaggcctacgacgccctgattgctcagggggtggccggttatggcggctat
ctgaaggcggcccgcgcgggggaagcgcccgccgccgtgttcaaggcattcaacagcttc
cagatcctctgcgccctgcgcgacggcccgttcggggtgcaggggcttaacgagcgcctc
gaactggccctgtcacgggctggcctgattgcccgcgatggcgactggtatgccggtcgc
ccggtgatggtggtgcgcaacgatcacggggtcggcctctataacggcgatatggggctc
tgcctgcccgatgaaagtgggcggctcaaggtatggtttgagcagccggacggcactctg
cgcgccctgttgcccagtcgcctgccacctcacgagacggtctacgccatgaccatccac
aaatcccagggctcggaatttgcccataccgtgctggtgctgcccgacagccccagcccg
ctgctgacccgcgagctggtctataccggcatcacccgcgccaaggcccgcctcgatctc
tacggcgatcgcgctctgctggcacaagcggtgcggaaaaagaccgagcgttattccgga
ttggcggagaggttgggggagtga

DBGET integrated database retrieval system