KEGG   Aeromonas veronii: B565_0340Help
Entry
B565_0340         CDS       T01462                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
avr  Aeromonas veronii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:avr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:avr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
362176..363657
Genome map
AA seq 493 aa AA seqDB search
MSRALDALLRPFGIQAPALTLTDIQLDSRRVGPGSLFVAIRGHQVDGRRFIEQAVAQGAT
AVVFEEDGEFIPPSTPVPCIGMRDLPAHLSALAGYFYDQPAQKLDLVGITGTNGKSTTAL
LVANWRTLLGGKAGVMGTIGNGLFGNLIEAENTTGSAVQVQANLAALQAQGADLVAMEVS
SHGLVQHRVAALPFAAAVFTNLSRDHLDYHGTMEAYGAAKEQLLQLVDESNAVINRDDEL
GAKWLEKYPAAVAFSVNGPIEHHSGRQLTAQQLDFHQQGFRAQINSSWGNGVLSAPLLGR
FNVSNVLAAMGVMLVLGYDFNELLATAPKLQPVTGRMECFGGGDTPLAVVDYAHTPDALE
KALQALRVHCTGQLWCLIGCGGDRDRGKRPMMAAMAEQYADRVILTDDNPRTEEPARIMA
DMVAGLRDPAAVQVEHDRVKAIALAIGQASKQDIILVAGKGHEDYQIIGTDKRHYSDRET
VAAALHTLLESFK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccgcgcacttgatgcattactgcgccccttcggtatccaggcgccggcgctcacc
ctgaccgatatccagctggatagtcggcgggttggccccggctcgcttttcgtggccatt
cgtggtcatcaggtggatggcagacggtttatcgaacaggcggtggctcagggagcgacc
gctgttgtgtttgaggaggatggtgaatttatcccgccatcgactccggttccctgtatc
gggatgcgggatctgcccgctcacctctctgctcttgcgggctatttctacgatcagcca
gcccaaaaattggatctggtcgggatcaccggcaccaacggcaagagcactacagcactg
ctggtcgccaactggcgcaccctgctgggtggcaaggcgggtgtgatgggcaccatcggc
aacggcctgtttggcaatttgatcgaagcggaaaataccaccggcagtgccgttcaggtg
caagccaatctggctgcgctgcaagcgcagggggcggatctggtggctatggaggtctcc
agccatggtctggtgcagcatcgtgttgccgcactgccgtttgccgctgccgttttcacc
aacctgagccgggatcacctcgactaccacggcaccatggaagcctatggcgcggccaaa
gagcagttgctgcaactggtcgatgagtcgaatgcagtgatcaaccgcgatgacgagctg
ggtgccaagtggctcgaaaagtacccggcagcggtggcgttcagcgttaatggcccgatt
gaacaccattctggccgtcaattaacggcgcagcagcttgattttcaccagcaaggtttt
cgcgcgcagattaactcaagctgggggaatggtgtattatccgcccccttgctcgggcgc
ttcaacgtcagcaatgtgctggccgcgatgggcgtgatgctggtgcttggttacgacttc
aacgagctgctggcaactgccccgaaattgcagccagtgaccggtcgcatggagtgtttc
ggcggtggcgatacgccgctggcggtggtcgattacgcccacaccccggatgcgctggag
aaggcattgcaggccctgcgggtgcactgcacaggccagctctggtgcctgatcggttgt
ggtggcgaccgcgatcgcggcaagcgccccatgatggccgccatggccgagcagtatgcg
gatcgcgtgatcctgaccgacgacaatccccgtaccgaggagccggcccggatcatggcc
gacatggtggcgggtcttcgcgatcctgctgcggtgcaggtggagcatgaccgggtcaag
gcgattgcgctggccatcggtcaggcgagcaaacaggacatcatcctggtggccggtaag
ggtcacgaggattatcagatcattggaaccgacaagcggcactacagcgaccgggaaacc
gttgcggccgccttgcacacattattggagtcattcaaatga

DBGET integrated database retrieval system