KEGG   Aeromonas veronii: B565_0379Help
Entry
B565_0379         CDS       T01462                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
avr  Aeromonas veronii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:avr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(415636..416145)
Genome map
AA seq 169 aa AA seqDB search
MTTIYISLGSNIERDRHIRAGLDALHAEFGELRVSRVFESEAVGFNGRPFYNLVAAAETD
LPLTTVCQRLRAMEFAHGREPDAKKFAPRTLDLDLLLYGDLVCDTPLVLPRGEVLTNAFV
LWPLAELAPKLRHPVDGRTMGELWQAYDKASQQLCPIPFHWEACELQHH
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatctatatcagcctgggctccaacatcgagcgggatcgccatattcgcgcc
gggctcgatgccctgcacgccgaatttggcgagctgcgggtctcccgggtattcgagagc
gaggcggtcggcttcaacggccgccccttctacaacctagtggcggctgccgagaccgat
ctgccgctgaccaccgtctgccagcgactgcgggccatggagttcgcccacggccgcgag
ccggatgccaagaagttcgccccgcgcaccctggatctcgatctgctgctctatggcgat
ctggtctgcgacaccccgctggtgctgccgcgcggtgaagtgctcaccaacgccttcgtg
ctgtggccgctggccgaactggcccccaaactgcgccaccccgtcgatggccgcaccatg
ggcgagctgtggcaagcctatgacaaggcctcccagcagctgtgccccattccctttcac
tgggaagcgtgcgaattgcagcatcactga

DBGET integrated database retrieval system