KEGG   Aeromonas veronii: B565_0559Help
Entry
B565_0559         CDS       T01462                                 

Definition
GGDEF domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
avr  Aeromonas veronii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(614257..615279)
Genome map
AA seq 340 aa AA seqDB search
MSKDTFAQSAAYLKQAVPLMIKYQIPTTPDNYHLWYNYVSASMPELNQAIDQAVKMQGTC
SLTTCERLYHQYLAAQDEKQMEAMKLSLAAMANELGHSMQDAISDTGMFQEMLDKSFDKL
SKIDDEGLSLEDTMGILRELVRESRDVRMSTMHFRNQLSNAEKEIKELRAALNETRKLAN
EDALTSLLNRRAFDLELEGLIRSQQSFSLILTDIDRFKSFNDEYGHLLGDQVLRAFSKRL
RDASKEGVTAYRIGGEEFALLLPHRSLALARQMAESMRRAIERMSILDRKSGRRIDHITA
SFGVGEFNGQESADSLVERTDKLLYKAKELGRNRVMPLPS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggacacatttgcccaatccgccgcctatctcaaacaggcggtccctttgatg
atcaagtaccagatccccacgacgccggacaattaccacctgtggtacaactatgtctcg
gccagcatgcccgagctcaaccaggcgattgatcaggcagtcaaaatgcagggaacctgc
tcgctcacgacctgcgagcgcctctatcaccagtatctggccgctcaggacgagaagcag
atggaggcgatgaaactgagcctcgccgccatggccaacgagctaggccactccatgcag
gacgccatctccgataccggcatgtttcaggagatgctcgacaagagtttcgacaagttg
agcaagatcgacgatgagggcctcagtctggaggacaccatggggatcctgcgggagctg
gtgcgcgaatcgcgggacgtgcgcatgtccaccatgcactttcgcaaccagctcagcaat
gcggagaaagagatcaaggagctgcgggcagccctaaacgagacacgcaagctggccaac
gaagatgccctcaccagcctgctcaaccgccgcgccttcgatctggagctggaggggctg
atccgcagccagcaatccttctcgctgatcctgactgatatcgatcgtttcaagagtttc
aacgacgagtatggccacctgctcggcgaccaggtcctgcgcgccttcagcaaacggctg
cgcgatgccagcaaagagggggtcaccgcctaccggattggcggagaagagtttgccctg
ctgttaccccatcgctcgctggcgctggccagacagatggcagagagcatgcgccgggct
atcgagcggatgtcgattctggatcgcaaatcgggccggcgcatcgaccacatcacagcc
tcgtttggcgtgggcgagttcaacggtcaggagagcgctgacagcctggtcgaacgtacc
gacaagctgctctacaaggccaaggagctggggcgcaaccgggtgatgccactcccttcc
tga

DBGET integrated database retrieval system