KEGG   Aeromonas veronii: B565_0626Help
Entry
B565_0626         CDS       T01462                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
avr  Aeromonas veronii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B565_0626
Enzymes [BR:avr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     B565_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(684539..686728)
Genome map
AA seq 729 aa AA seqDB search
MTTLIEQLAAAKGIASEYVDAWGHPAQVSEESKAAMLGAMGYRVDDEEALVQQLEEEHRQ
HWLRALDPVMVVRTGDAVTLEVRLPIEFVNDALTWQLQQEQGAVLSGQFTPIEGELVGVA
EFEEMECQAYRVTLDMAPELGYHQLVLLEEGNDEPLATMRLIVAPKACYKQAPIANGRKV
WGPSVQLYCLRSRHNWGIGDFSDLGQLVEKAAAWGAHFVGLNPIHALYPANPESASPYSP
SSRRWLNVAYINVEAVPEFRQSDRLKAEVASPAFQQHLADLRAKENVDYTGVLQTKLGML
RQVFNEATLSAERQAAFDAFVAAGGDSLQQQAAFDALQAHFYAKGENAWGWPVWPQELRD
YHNPAVAAWMAAHPQDVNFYLYLQFLADEQLAQADARAKAAGMVMGIYRDLAVGVSEGST
EIWANQDLYCPKASVGAPPDILGPLGQNWGLPPMNPNKLFEAAYQPMVDLFRANMRSCGA
LRIDHVMALLRLWWVPPGASAAKGAYIYYPVNDLLGILALESHRNQCLLIGEDLGTVPEG
IDVTLKENGVHSYKVFFFERSKEDGGFISPAHYTEQAMSALTTHDMPTLKGFWHCDDLAL
GRQLGLYPDEDVLKTLYADRHQAKQRILDSLHAHKVISDNISHDVNWVGMNTELNHGLQI
HMSRGSCALFSTQLEDWLEMDKPVNVPGTSYEYPNWRRKLSADLEDIFANEALKALAGKM
SQARDEASR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctgattgaacagctggctgccgcaaaaggtatcgccagcgagtatgtcgat
gcttggggccacccggcccaggtatccgaagagagcaaggccgccatgctgggcgccatg
ggctaccgcgtcgatgacgaggaagcactggtgcagcagctggaagaggagcatcgccag
cactggctgcgggcgctggatcctgtgatggtggttcgcaccggcgacgccgtcacgctc
gaagtccgtctccccatcgaattcgtcaacgatgccctcacctggcagctccagcaggag
cagggtgctgtgctgtccggtcaattcactcccatcgagggcgagctggttggcgtggcc
gaatttgaagagatggagtgccaggcctatcgcgtcacgctggatatggccccggagctg
ggttatcaccagctggtgctgctggaagagggcaatgacgagccgctggccaccatgcgc
ctcatcgtcgcccccaaggcctgctacaagcaggcgccaattgccaatggccgcaaggta
tggggcccgagcgtgcagctctactgcctgcgcagccgccacaactggggtatcggtgat
ttcagcgatctgggccagctggtcgaaaaagccgccgcctggggtgcccacttcgtcggc
ctcaaccctatccacgccctctatccggccaatccggagagcgccagtccatacagcccc
tcttcccgtcgctggctcaacgtggcctatatcaatgtggaagcggtgcccgaattccgg
cagagcgatcgcctgaaagcggaagtggcgagccctgccttccagcaacatctggccgat
ctgcgtgccaaagagaatgtcgattacaccggcgtgctccagaccaaactcggcatgctg
cgtcaggtgttcaatgaagccaccctgagcgccgagcgtcaggccgcctttgatgccttc
gtggccgccggtggcgacagcctgcaacagcaggcagcattcgatgccctgcaggcccac
ttctatgccaaaggcgaaaatgcctggggctggccggtatggccgcaggagctgcgcgat
taccacaaccctgccgttgccgcctggatggccgcgcacccgcaagatgtcaacttctac
ctctatctgcagttcctggccgacgagcagctggcgcaagccgatgcccgtgccaaggct
gccggcatggtgatggggatctaccgggatctggcagtgggcgtctccgaaggctccacc
gagatctgggccaatcaggatctctactgcccgaaagcctcggtcggtgcgccgcccgat
attctcggcccgcttggtcagaactggggcctgcccccgatgaacccgaacaagctgttt
gaagcggcctatcagccgatggtggacttgttccgtgccaacatgcgctcctgtggcgca
ctgcgtatcgaccacgtgatggccttgctgcgcctgtggtgggtaccgcccggagcgtcc
gcagccaagggcgcctacatctactatccggtcaacgacctgctgggcattctggccctc
gaatcccaccgcaatcagtgcctgctgatcggcgaggatctgggcaccgtgccggagggg
atcgacgtgactctgaaagagaacggcgtccactcctacaaggtgttctttttcgagcgc
tccaaggaagatggcggctttatctccccggcacactacaccgagcaggcgatgtcggcc
ctgaccacccacgacatgccgaccctcaagggcttctggcattgcgacgatctggcgctc
ggccgtcaactgggtctgtatccggatgaagatgtattgaagactctgtatgctgatcgt
caccaggccaaacagcggatcctcgacagcctgcatgcccacaaggtcatctctgacaac
atcagtcatgacgtgaactgggtcggcatgaacaccgaactcaaccacggtctgcagatc
cacatgtcccgcggcagctgcgccctgttcagtacccagctggaagattggctggagatg
gacaagccggtcaacgtaccgggcaccagttacgaataccccaactggcgccgcaagctt
tccgctgatctggaagatatttttgccaatgaggcactcaaggcactggctggcaagatg
agccaagcccgtgatgaggccagtcgttga

DBGET integrated database retrieval system