KEGG   Aeromonas veronii: B565_0628Help
Entry
B565_0628         CDS       T01462                                 

Definition
Aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
avr  Aeromonas veronii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:avr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
688158..689024
Genome map
AA seq 288 aa AA seqDB search
MQSIRPLTANCKLANNAAGLPVLTINNDYAKAEISLFGAHVLSYQRHGEPASIWLSDKAV
LDGSKPVRGGIPICWPWFGPAPARVGSGKPSHGFARTTLWMLDGVSDHTDGTLVHLSLHD
SDATRALWDHPFELELDVLVGKELSLVLTTRNTGAQPLTYSGALHTYLQISAPEAVSVTG
LGEPYADKLTGQDAKQQGALTLNGPLDRVYWQPEALVRVQDGERETRVVSGNHDSVVVWT
PWLEGATAMADMSDDGYRTMLCVEAAIAGDAGVTVAPDEEHSFSTVII
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccattcgtcccctgacagccaattgcaagcttgccaacaatgccgccggtctg
ccggttctcaccattaataacgactatgccaaggccgagatcagcctgtttggcgcacat
gtgctgagctatcagcgtcatggcgagccggcctccatctggctgagtgacaaagcggtg
ctggatggcagcaagcctgttcgtggtggtatcccgatctgctggccctggtttggcccg
gcgcccgcccgcgtcggtagcggcaagccctcccacggttttgcccgtaccaccctctgg
atgctggacggggtctccgatcacaccgatggcacgcttgttcatctctccctgcacgac
agcgatgcgacccgtgccctgtgggatcaccccttcgagctggaactggacgtgctggtg
ggcaaagagctttcgctggtgctgaccactcgcaacacaggtgctcagccgttgacctat
agcggtgcgctgcatacctatttgcagatcagcgcaccagaggcggtaagcgtcaccgga
ctgggcgagccctatgccgacaagctgaccggacaggatgccaagcagcagggtgcattg
accctgaacgggccgctggatcgggtctactggcagccagaggcgctggtgagggtgcag
gatggtgagcgcgagacgcgggtagtgagcggcaaccacgacagcgtggtggtctggacc
ccttggctggaaggggccaccgccatggccgacatgagcgacgatggctatcgcaccatg
ctctgcgtcgaagcggccatcgccggcgacgctggggtgaccgtcgcgccggatgaagag
cacagcttctccaccgtaatcatctga

DBGET integrated database retrieval system