KEGG   Aeromonas veronii: B565_0859Help
Entry
B565_0859         CDS       T01462                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
avr  Aeromonas veronii
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    B565_0859
Enzymes [BR:avr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     B565_0859
   3.1.2  Thioester hydrolases
    3.1.2.-  
     B565_0859
Lipid biosynthesis proteins [BR:avr01004]
 Fatty acid synthase
  Component type
   B565_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(950291..950902)
Genome map
AA seq 203 aa AA seqDB search
MVRILFALFVGLGSLLSSAQAQTLLVLGDSLSAGYQMQVEQSWPALLNQKWQEEGGKHTL
LNASISGETTQGALARLPALLKEHKPDWLLIELGGNDGLRGFAPTITRQNLASMIALAKE
QQTRVVLTQIQLPRNYGARYLRQFEQIFPELAQANDLPLLPFFMDDIALRPELMMNDGIH
PTPAAQPQIRDKVARFMEPLLSQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtattctgtttgccttgttcgttggccttggcagcctgctttcatcggctcag
gcccagaccctgttggtgctgggagacagcctgagcgccggctatcagatgcaggttgag
cagagctggcccgccctgctcaaccagaaatggcaggaggaggggggcaaacacaccctg
ctcaatgccagcatcagcggtgaaacgacccaaggggcgctggcccgtctgcccgctctg
ctgaaggagcacaagccggactggctgctgatcgaactggggggcaacgatggcctgcgc
ggcttcgcaccgaccattacccgccagaatctggccagcatgatcgcgctcgccaaggag
cagcagacccgtgtggtgttgacccaaatccagctgccccgcaactacggtgcccgctat
ctgcgccagttcgaacagatctttcccgagttggcccaggctaacgatctgccgctgctg
cccttctttatggatgatattgcgctgcgccctgaacttatgatgaacgatggtattcat
cccaccccggcggcccagccacaaatccgcgataaagtcgcccgctttatggagccgctg
ctcagccaataa

DBGET integrated database retrieval system