KEGG   Aeromonas veronii: B565_0911Help
Entry
B565_0911         CDS       T01462                                 

Definition
disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
avr  Aeromonas veronii
Brite
Enzymes [BR:avr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     B565_0911
Secretion system [BR:avr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   B565_0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1005458..1006132
Genome map
AA seq 224 aa AA seqDB search
MCTFAARAGMDTQALKQTITARLGVPVYLVEPTPIAGLYMLGTSQGVLYSDAKGDYVVQG
VMLDMTRDMKNLTISGMREQRRLGLAQVAHAPIVLKARDERHRVALFLGEQDAKRRQLSG
TLQHLQASGVSVALYPVIDHAERAADWCSDPLLQNDPLKAYLPQTACSETLIQNIGLSQW
LGVKVLPAWVSSDGDLVRGYQSPEQLLKILDHIDVPANPSSSAS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcacatttgctgccagagcggggatggatacccaagccttgaaacagaccatcaca
gcccggctgggggtccccgtctatctggttgaaccgaccccgatcgcggggttgtatatg
ctgggcacctcacagggggtgctctacagcgatgccaaaggggattatgtggtgcagggg
gtcatgctggatatgacccgcgacatgaagaacctgaccatctcgggtatgcgcgagcag
cgccgacttggtttggcgcaggtggctcatgcccccattgtgctcaaggctcgggatgag
cgtcaccgggtcgcgctgtttctcggcgagcaggacgccaaacgccgtcagctctccggc
accttgcaacacctgcaggcatccggggtgagcgtggctctctatccggtgattgatcac
gccgaacgggccgccgactggtgcagcgatcccctgctgcaaaatgatccgttaaaagcc
tatttgcctcaaacggcatgtagtgagacccttatccaaaatattggcctgagccaatgg
ttgggggtcaaggtactgccggcctgggtctcctccgatggggatctggtgcgcgggtat
cagagccccgaacagctgctcaagatactggatcatattgatgtccctgcaaatccgtcg
tcgtccgcgagttga

DBGET integrated database retrieval system