KEGG   Aeromonas veronii B565: B565_0999Help
Entry
B565_0999         CDS       T01462                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
avr  Aeromonas veronii B565
Pathway
avr00900  Terpenoid backbone biosynthesis
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B565_0999
Enzymes [BR:avr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     B565_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEB49034
Position
complement(1103666..1104514)
Genome map
AA seq 282 aa AA seqDB search
MASTRWPAPAKLNLFLHVNGRRPDGYHELQTLFIFLNHSDWLEFEVIPNSDTLTLNPAIP
GVPDEQNLIIRAARLLQATLPSPQGAHIRLEKVLPMGGGIGGGSSDAATTLVALNHLWQA
GLSEDELAALGVQLGADVPVFVRGKAAFAEGVGERLQPVELPDAWYLVLKPDCHVATAAV
FQDPDLPRATPKMALDNLLEGEWKNDCESLVKKRHPEVANALGWLLEYAPSRMTGTGACV
FAQFEDEVTAREVLACVPKGLDGFVAKGENISPLFSTLQQFK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcttccacacgctggccggcaccggccaaactcaacctgtttttacacgtcaatggc
cgtcgtcccgatggctatcacgagctgcagaccctgtttatcttcctcaaccacagcgac
tggctcgagttcgaggtgataccgaatagcgacacactcaccctgaacccggccattccc
ggggtgccggatgagcagaatctgattatccgggcggcgcggctgctgcaggcaaccctg
ccgagcccgcaaggtgcccatatccggctggagaaagtgctgcccatggggggcggcatt
ggcggcggttcatccgatgcagcgaccacgctggtagcgcttaaccacctctggcaagcg
ggtttgagtgaagatgaactggcagcgcttggcgtccagttgggggccgatgtgccggtg
tttgtccgtggcaaggcggcctttgccgaaggagtgggcgagcggctgcaaccggtcgaa
ctgcccgatgcctggtatctggttctcaagcccgattgccatgtggcgaccgcggccgta
ttccaggatccggacctgccgagagccacgccgaaaatggcgctggacaacctgctggaa
ggcgagtggaaaaacgattgcgaatcactggtgaaaaagcgccaccccgaggttgccaat
gcgctcggctggttgctagaatacgcgccgtcaagaatgacgggcacaggagcctgcgtc
tttgctcaatttgaagacgaagtgactgctcgggaagtgttggcctgcgtgccgaaggga
cttgatgggtttgtcgccaagggcgagaacatatcacctctcttctccacattgcaacag
ttcaaatga

DBGET integrated database retrieval system