KEGG   Aeromonas veronii B565: B565_1120Help
Entry
B565_1120         CDS       T01462                                 

Definition
(GenBank) Two-component system response-regulator/protein-glutamate methylesterase CheB
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
avr  Aeromonas veronii B565
Pathway
avr02020  Two-component system
avr02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:avr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B565_1120
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    B565_1120
Enzymes [BR:avr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     B565_1120
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     B565_1120
Two-component system [BR:avr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   B565_1120
Bacterial motility proteins [BR:avr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    B565_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AEB49155
Position
1235947..1237062
Genome map
AA seq 371 aa AA seqDB search
MAVKVLVVDDSSFFRRRVSEIINQDPMLTVIDTAQNGREAVDKAMSLRPDVITMDIEMPV
MDGISAVREIMAKCPTPILMFSSLTHEGAKATLDALDAGALDFLPKKFEDIARDKDEAVR
LLQQRVKEISRKRFLMTSAARPKAPEPVARAPLGSTVPRTSDRQPDLQRTVPSASFKRSG
KSYQLVAIGTSTGGPVALQNVLTKLPGDFPHPILLIQHMPATFTAAFAARLNGLCQIGVK
EAEDGDVLKPGHAYLAPGGKQMLLEGRGIGARIRIVDGNDKVNYKPCVDITFASAAKTYA
DKVLAIVLTGMGADGRDGARLLKEQGSTIWAQDEASCVVYGMPQAVAKAGIASESLPLDK
VAQRILVELGR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtattagttgtcgacgattcgagcttctttcgccgtcgggtgagcgag
atcatcaatcaggatcccatgctgacggtgattgatacggcccagaatggacgtgaggcg
gtggacaaggcgatgtcgctgcgccctgatgtgatcaccatggacatcgaaatgcccgtg
atggatggcatcagtgcggtgcgggagatcatggccaagtgcccaacccccattctgatg
ttctcctccctgacccatgaaggggccaaggctacgctggatgcgctggacgccggtgcc
ctggacttcttgcccaagaagtttgaggacattgccagagacaaagatgaagcggtcaga
ctgttgcaacaacgggtgaaggagatctcccgcaagcgcttcctgatgacatccgctgct
cgccccaaagcacctgaaccggttgctcgtgctcctctgggcagcactgtgcccagaact
tcagatcgtcagcctgacctgcaacgtactgtgccaagtgcttcattcaagcgcagtggc
aagagttatcagttggtggcgatcggcacttctaccggcggacctgttgcgttgcaaaat
gtgctgaccaagttgccgggggattttccccatcccatcctgcttatccagcatatgcca
gccacttttactgccgcgtttgctgcccgtctcaacgggttatgtcagattggcgtcaag
gaagcggaagatggcgatgtgcttaaaccagggcatgcctaccttgctcccggtggtaag
cagatgctgttggaaggtcgtggaataggggcccgtattcgcatcgtggatggcaacgac
aaggtaaattacaagccttgtgtggatatcacctttgcctctgcggccaagacctatgcc
gacaaggtattggcgattgtgctgaccggtatgggcgcagatggccgtgatggcgccaga
ctgctgaaagagcagggctcaaccatctgggctcaggatgaggcttcctgcgtggtatat
ggtatgccgcaagcggtagccaaagcggggattgccagcgaatcactccctctggacaag
gtggcccagcgtattctggttgagttggggcgctaa

DBGET integrated database retrieval system