KEGG   Aeromonas veronii: B565_1120Help
Entry
B565_1120         CDS       T01462                                 

Definition
two component system response-regulator/protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
avr  Aeromonas veronii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:avr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:avr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1235947..1237062
Genome map
AA seq 371 aa AA seqDB search
MAVKVLVVDDSSFFRRRVSEIINQDPMLTVIDTAQNGREAVDKAMSLRPDVITMDIEMPV
MDGISAVREIMAKCPTPILMFSSLTHEGAKATLDALDAGALDFLPKKFEDIARDKDEAVR
LLQQRVKEISRKRFLMTSAARPKAPEPVARAPLGSTVPRTSDRQPDLQRTVPSASFKRSG
KSYQLVAIGTSTGGPVALQNVLTKLPGDFPHPILLIQHMPATFTAAFAARLNGLCQIGVK
EAEDGDVLKPGHAYLAPGGKQMLLEGRGIGARIRIVDGNDKVNYKPCVDITFASAAKTYA
DKVLAIVLTGMGADGRDGARLLKEQGSTIWAQDEASCVVYGMPQAVAKAGIASESLPLDK
VAQRILVELGR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtattagttgtcgacgattcgagcttctttcgccgtcgggtgagcgag
atcatcaatcaggatcccatgctgacggtgattgatacggcccagaatggacgtgaggcg
gtggacaaggcgatgtcgctgcgccctgatgtgatcaccatggacatcgaaatgcccgtg
atggatggcatcagtgcggtgcgggagatcatggccaagtgcccaacccccattctgatg
ttctcctccctgacccatgaaggggccaaggctacgctggatgcgctggacgccggtgcc
ctggacttcttgcccaagaagtttgaggacattgccagagacaaagatgaagcggtcaga
ctgttgcaacaacgggtgaaggagatctcccgcaagcgcttcctgatgacatccgctgct
cgccccaaagcacctgaaccggttgctcgtgctcctctgggcagcactgtgcccagaact
tcagatcgtcagcctgacctgcaacgtactgtgccaagtgcttcattcaagcgcagtggc
aagagttatcagttggtggcgatcggcacttctaccggcggacctgttgcgttgcaaaat
gtgctgaccaagttgccgggggattttccccatcccatcctgcttatccagcatatgcca
gccacttttactgccgcgtttgctgcccgtctcaacgggttatgtcagattggcgtcaag
gaagcggaagatggcgatgtgcttaaaccagggcatgcctaccttgctcccggtggtaag
cagatgctgttggaaggtcgtggaataggggcccgtattcgcatcgtggatggcaacgac
aaggtaaattacaagccttgtgtggatatcacctttgcctctgcggccaagacctatgcc
gacaaggtattggcgattgtgctgaccggtatgggcgcagatggccgtgatggcgccaga
ctgctgaaagagcagggctcaaccatctgggctcaggatgaggcttcctgcgtggtatat
ggtatgccgcaagcggtagccaaagcggggattgccagcgaatcactccctctggacaag
gtggcccagcgtattctggttgagttggggcgctaa

DBGET integrated database retrieval system