KEGG   Aeromonas veronii: B565_1222Help
Entry
B565_1222         CDS       T01462                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
avr  Aeromonas veronii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B565_1222
Enzymes [BR:avr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     B565_1222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347020..1347676
Genome map
AA seq 218 aa AA seqDB search
MTTLSPEALLVRAALEAQGLETPLVTNELNSQQKREKIEGHMRSIMETLGLDLTDDSLAE
TPHRIAKMYVNEIFSGLDYSTFPKVTVIENKMQVDEMIMVRDISLTSTCEHHFVTIDGMA
HVAYIPRGKVIGLSKINRIVQFFARRPQVQERLTQQILLALQTLLGTKDVAISIKATHYC
VKARGVMDSTSYTTTTSLGGVFKTQPDTRAEFLGGLRG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccttaagtccggaagccttgctggtcagggctgccctcgaagcccagggactg
gaaacccccctggtcaccaacgagctgaacagccagcagaagcgggagaagatcgaaggc
catatgcgctccatcatggagacactggggctggatctgaccgatgacagtctggccgag
acgccgcaccgcatcgccaagatgtacgtcaacgagatcttctccggcctcgattattcc
accttccccaaggtgacagtgatcgagaacaagatgcaggtggacgagatgatcatggtg
cgggatatcagcctcaccagcacctgcgaacaccacttcgtcaccatcgacggcatggcc
catgtggcctatatccctcgtggcaaggtgattggcctgtcgaagataaaccgcatcgtg
cagttttttgcccgccgtccccaggtgcaggagcggctcacccagcagatcctgctggcg
ctgcagaccctgctcggcaccaaggatgtggccatcagcatcaaggcgactcactactgc
gtcaaggcgcgcggagtgatggactccacctcctataccaccaccacctccctcggcggg
gtgttcaagacccagcccgatacccgggccgagtttctgggcggcctgcgcggataa

DBGET integrated database retrieval system