KEGG   Aeromonas veronii: B565_1539Help
Entry
B565_1539         CDS       T01462                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
avr  Aeromonas veronii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    B565_1539
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B565_1539
Enzymes [BR:avr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     B565_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1715839..1716390
Genome map
AA seq 183 aa AA seqDB search
MNVIKTAIPDVLIFEPKVFGDERGFFFESFNHKLFEEAVGYQVNFVQDNHSKSSKGVLRG
LHYQLPPNAQGKLVRCVAGEVFDVAVDIRKSSPTFGKWVGVHLSGENKRQLWIPEGFAHG
FVTLTETAEFLYKTTNYYAPVSDRGIAWNDASIGIKWPELNADILTSAKDSTAKSLETAD
LFI
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaatcaagacagcgattcctgatgtgcttatttttgaacccaaagtatttggt
gatgaacgtggttttttctttgagagtttcaaccacaagttatttgaagaggccgtagga
tatcaggttaactttgtgcaggataatcactccaaatcgtcgaaaggggtattgcgtggc
ttgcattatcaattgcctcccaatgcccaaggcaagctggtgcgctgtgtggcgggtgaa
gtgtttgatgtggcggtcgatatccgcaaaagctcaccgacctttggaaaatgggtcggt
gttcatctgtcaggtgaaaacaagcgacagttgtggatcccggaagggtttgcccatggt
tttgtcacgctgacagaaacggctgagtttttatataaaacaacgaattattatgcacca
gtgagcgatagaggtattgcatggaatgatgcctcgattggtattaaatggcccgaatta
aacgcggacatccttacctctgcaaaagatagtactgccaagtcattagagaccgcagac
ctgtttatctaa

DBGET integrated database retrieval system