KEGG   Aeromonas veronii: B565_1542Help
Entry
B565_1542         CDS       T01462                                 

Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
avr  Aeromonas veronii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:avr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1720698..1722362)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGILDIKSDAVALRKSALEMSKRLRHRGPDWSGVYSSDKAILVHERLAIVDPGNGA
QPLYNPERTHVLAVNGEIYNHKELEKTLKVDFQFQTKSDCEVLLALYKEKGPAFLDDLNG
IFAFILYDAEQDAYLIGRDHMGIIPLYTGRDEHGNFYVASEMKALVPVCKSVETFPPGHY
LWSKDGELKQWYKRDWMEYAAVEHNVSDKAELKAALEAAVKRQLMCDVPYGVLLSGGLDS
SVISAITKLYAARRIEDDGKSEAWWPQLHSFAVGLEGSPDLAAARKVADHLGTIHHQIHF
TVQEGLDALRDVIYHLETYDVTTIRASTPMYLMARYIKAMGIKMVLSGEGSDELFGGYLY
FHKAPNAREFHEENVRKLASLHLYDCLRANKSMAAWGVEGRVPFLDKEFMDVAMRLQPAD
KMCGKGKIEKHILREAFEDLLPHEVAWRQKEQFSDGVGYSWIDSLKAMVEQEVTDQMFEA
AAFRFPINTPLTKEAYFYRAIFDEHFPLEAAARTVPYGKSVACSTPTALEWDAKFKEMAD
PSGRAVMDVHQQGY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaattttcggcattctggatatcaagtccgatgcagtagccctgcgcaaatcg
gcgctggagatgtccaagcgacttcgtcaccgcgggcctgactggtccggcgtctacagc
tccgacaaagccattctggtgcacgagcgtctggccatcgtcgacccgggcaatggcgcc
cagccgctgtacaaccccgagcgcacccatgtgctggcggtcaatggcgagatctacaac
cacaaagagctggaaaagaccctcaaggtcgatttccagttccagaccaaatccgactgt
gaagtgctgctcgccctttacaaggagaagggcccggcgtttctcgacgatctcaacggc
atctttgccttcatcctttatgacgccgaacaggatgcctacctgattggtcgcgaccac
atggggatcatccccctctataccggtcgcgacgagcacggcaacttctatgtcgcctcc
gagatgaaggcgctggtgccggtctgcaagagcgtcgaaaccttcccgccgggacactac
ctgtggagcaaggatggcgagctaaaacagtggtacaagcgcgactggatggagtacgcc
gcggtcgagcacaacgtcagcgacaaggccgagctgaaagccgcgctggaagcggcggtc
aaacgccagctgatgtgcgatgtgccttatggcgtgctgctctcaggtgggctggactcc
tccgtcatctccgccatcaccaagctctatgcggcgcgccgcatcgaggacgatggcaag
agcgaagcctggtggccgcaactgcactccttcgccgtcggtctggaagggtcgccggat
ctcgccgccgcccgcaaggtggctgatcatctgggcaccatccaccaccagatccacttc
accgtgcaggagggtctggatgccctgcgcgatgtcatctatcacctcgagacctatgac
gtcaccaccattcgcgcctccacgcccatgtacctgatggcccgttacatcaaggcgatg
gggatcaagatggtgctctccggcgaaggctcagacgagctgttcggtggctatctctac
ttccacaaggcgcccaacgcccgcgagttccacgaagagaacgtgcgcaagctcgcctcc
ttgcacctctatgactgcctgcgcgccaacaagtcgatggccgcctggggtgtggagggt
cgcgtgcccttcctcgacaaggagttcatggacgtggcgatgcgcctgcagcccgccgac
aagatgtgcggcaagggcaagatcgagaagcatatcctgcgcgaagcgttcgaggatctg
ctgccccacgaagtggcgtggcgccagaaggagcagttctccgacggcgtaggctattcg
tggatcgacagcctgaaagccatggtagaacaggaagtgacggatcagatgttcgaagcg
gctgcattccgcttccccatcaacaccccgctcaccaaggaagcctacttctaccgcgcc
atcttcgacgagcacttcccgctggaagccgccgcccgtaccgtgccctacggcaagtcg
gtcgcctgctccacccccaccgcgctggagtgggatgccaagttcaaggagatggcagat
ccctccggccgcgccgtgatggacgtgcaccagcagggctactga

DBGET integrated database retrieval system