KEGG   Aeromonas veronii: B565_1643Help
Entry
B565_1643         CDS       T01462                                 

Definition
aryl-phospho-beta-D-glucosidase BglC
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
avr  Aeromonas veronii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:avr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1838175..1839608
Genome map
AA seq 477 aa AA seqDB search
MHHHKFNDFPSDFLWGAASAAYQVEGGWNADGKGPSVWDLFTKLPGKTFEGSNGDVAVDH
YHRMEEDVALMAEMGVKAYRFSVSWPRIYPTGRGEVNEAGLAFYEKLIDTLLAHQIEPVL
TLYHWDLPQALQDEYGGWEDRRIIEDFERYCVTLYQRFAGKVKYWVSLNEQNYNLTNAYQ
LGTHPPAVQDRKRFFAANHIAFLANARVIKAFRQHVPNGLIGPSFAYSPAYPASCDPKDM
LAYENAEEFNNLWWLDAYCFGRYPQAALAYLRENGEAPEILPGDMELLREGTPDYMGVNY
YYTLTYTDNPLGGQTLQRINTTGKKGTTPSSGIPGLYKTAPNPHLETSNWDWAIDPTGMR
IALRRLSSRYGLPLMITENGLGEFDKLEAGDKVNDEYRIDYLRSHVKACQEAMQDGVELL
GYCAWSFTDILSWLNGYQKRYGFVYVERDEQGGSLRRIKKASFHWYSQVIASQGKQL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaccacaagttcaacgacttcccgagcgattttctgtggggcgccgcctccgcc
gcctatcaggtggagggaggctggaatgccgatggcaaggggccctcagtgtgggatctc
ttcaccaagctgccgggcaagacctttgaggggagcaacggcgatgtggcggtggatcac
taccaccgcatggaagaggacgtggcgctgatggccgagatgggggtcaaggcttaccgc
ttctcggtgagctggccgcgcatctatcccaccggtcggggggaggtgaacgaggcgggg
ctggccttctatgagaagctgatcgacaccctcttggcccaccagatcgagccggtgctg
accctttatcactgggatctgccgcaggcgctgcaggatgagtacggcggttgggaagac
cgacgcattatcgaggatttcgagcgctactgcgtgaccctctatcagcgctttgccggc
aaggtgaagtactgggtctctctcaacgagcagaactacaacctgactaacgcctatcag
ctcggcacccatccgcccgctgtgcaggatcgcaagcgcttctttgccgccaaccacatc
gcgtttctggccaatgcccgggtgatcaaggcgtttcgccagcatgtgccaaatggcctc
atcggcccgagctttgcctactctcctgcctatccggcgtcgtgcgatccgaaagatatg
ctggcctatgagaacgccgaggagttcaacaacctctggtggctggatgcctactgcttt
ggccgctatccgcaggcggcgctcgcttacttgcgagaaaacggcgaggcgccggagatc
ctgccaggcgatatggagttgctgcgagaggggacgcccgactacatgggcgtcaactac
tactacaccctgacctacacagataaccccttgggcggccagaccctgcagcggatcaac
accaccggcaagaagggcaccacgccgtccagcggcatccccggcctctacaagacggcg
cccaatccgcaccttgaaaccagcaactgggactgggccatcgacccgaccgggatgcgt
atcgccctgcgtcgcctctcttcccgctatggtctgccgctgatgatcaccgagaacggt
cttggcgagttcgacaagctggaggcgggcgacaaggtgaacgatgagtaccgcatcgat
tacctgcgcagccacgtcaaggcgtgccaggaggcgatgcaggatggggtggaattgctc
ggctactgcgcctggtcgttcaccgacatcctgagctggctcaacggctatcagaagcgc
tacggcttcgtctatgtggagcgtgacgagcaggggggctcccttcgccggatcaagaag
gcgagcttccactggtatagccaggtgattgcgagccagggcaagcagctctga

DBGET integrated database retrieval system