KEGG   Aeromonas veronii: B565_1672Help
Entry
B565_1672         CDS       T01462                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
avr  Aeromonas veronii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B565_1672
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B565_1672
   00650 Butanoate metabolism
    B565_1672
  Energy metabolism
   00190 Oxidative phosphorylation
    B565_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1869337..1869681
Genome map
AA seq 114 aa AA seqDB search
MVTNSATFGRSGVHDYILIRATALIMTCYVLYLVGFVAFNDITYEVWAGFFAKTFTKVFT
LLTLLCVLIHAWIGLWQVLTDYIKPVGLRGALQFALVVVLFVYLMTGFVVLWGV
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaattctgcaaccttcgggcgcagcggcgttcacgattacatcctgatccgc
gccaccgccctcatcatgacctgttatgtcctctatctggtgggctttgtcgcgttcaac
gacatcacctacgaggtgtgggcaggcttcttcgccaaaacattcaccaaggtattcacc
ctgttgaccctgctctgcgtactgatccacgcctggattggtctgtggcaggtgctgact
gactatatcaagccggtagggctacgcggggcgctgcaatttgccctggtcgtggtgctg
tttgtctatctgatgacgggtttcgtcgtgctgtggggtgtgtaa

DBGET integrated database retrieval system