KEGG   Aeromonas veronii B565: B565_1677Help
Entry
B565_1677         CDS       T01462                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
avr  Aeromonas veronii B565
Pathway
avr00020  Citrate cycle (TCA cycle)
avr00640  Propanoate metabolism
avr00660  C5-Branched dibasic acid metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
Module
avr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B565_1677
   00640 Propanoate metabolism
    B565_1677
   00660 C5-Branched dibasic acid metabolism
    B565_1677
Enzymes [BR:avr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B565_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEB49712
Position
1876503..1877669
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEYGLPVSEGYACATPQEAAEAADKIGGNTWVVKCQVHAGGRGKAGGV
KVAKSKDEIRAFAQNWLGKNLVTYQTDANGQPVTKILVESCTDIAKELYLGAVVDRGSRR
VVFMASTEGGVDIEKIAHETPHLIHKAAIDPLVGPQAYQARELAFKLGLVGDQIKQFTKI
FMGLGQMFLDCDFALLEINPLVITAQGNLHCLDGKINIDANALYRQPKLREMHDPSQDDP
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDNNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGGIK
LAESGLNIIAAKSLTDAAQQVVKAAEAN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcatgaatatcaggcaaaacagctgtttgccgagtatggcctgccggtctcc
gaaggttatgcctgtgctaccccacaagaagcggccgaagcggccgacaagattggcggc
aatacctgggtcgtcaaatgccaggtacacgccggtggccgcggtaaagcgggcggcgtg
aaagtggccaagagcaaggatgagatccgtgcttttgcccaaaactggcttggcaaaaat
ctggtgacctaccagaccgacgccaacggccagccggtcaccaagatcctggtggaatct
tgcaccgacatcgccaaagagctctacctgggcgccgtagttgaccgtggttcgcgccgc
gtggtcttcatggcctcaaccgaaggtggcgtggatatcgagaagatcgcccacgaaacc
ccccatctgatccacaaggcggctatcgatccgctggtgggtccgcaggcttatcaggcc
cgcgaactggccttcaaactgggtctggtcggcgatcagatcaaacagttcaccaagatc
ttcatgggtctgggccagatgttcctggattgcgatttcgcgctgctggagatcaacccg
ctggtgatcaccgcgcagggcaacctgcactgcctggatggcaagatcaacatcgatgcc
aacgcactgtatcgtcagcccaagctgcgcgagatgcacgacccgtcacaagatgacccc
cgcgaagcgcacgccgcccagtgggagctcaactatgtggccctcgatggcaacatcggc
tgcatggtcaacggcgcgggtctggccatgggcaccatggacatcgtcaacctgcacggc
ggcaaaccggccaacttccttgacgtcggcggcggcgccaccaaggagcgcgtaaccgag
gcgttcaagatcatcctctccgacaacaacgtcaaagcggtgctggtcaacatcttcggc
ggcatcgtgcgctgcgacatgatcgcagaaggcatcattggtgcggtcaaggaagtgggg
gtcaaggtgcccgtcgtggtccgtctggaaggcaacaacgccgagctgggtggtatcaag
ctggccgagagcggcctcaacatcattgcggccaagagtctgaccgatgccgcgcagcaa
gtcgtcaaagcagcggaggccaactga

DBGET integrated database retrieval system