KEGG   Aeromonas veronii: B565_1677Help
Entry
B565_1677         CDS       T01462                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
avr  Aeromonas veronii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B565_1677
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B565_1677
   00640 Propanoate metabolism
    B565_1677
   00660 C5-Branched dibasic acid metabolism
    B565_1677
Enzymes [BR:avr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B565_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1876503..1877669
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEYGLPVSEGYACATPQEAAEAADKIGGNTWVVKCQVHAGGRGKAGGV
KVAKSKDEIRAFAQNWLGKNLVTYQTDANGQPVTKILVESCTDIAKELYLGAVVDRGSRR
VVFMASTEGGVDIEKIAHETPHLIHKAAIDPLVGPQAYQARELAFKLGLVGDQIKQFTKI
FMGLGQMFLDCDFALLEINPLVITAQGNLHCLDGKINIDANALYRQPKLREMHDPSQDDP
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDNNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGGIK
LAESGLNIIAAKSLTDAAQQVVKAAEAN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcatgaatatcaggcaaaacagctgtttgccgagtatggcctgccggtctcc
gaaggttatgcctgtgctaccccacaagaagcggccgaagcggccgacaagattggcggc
aatacctgggtcgtcaaatgccaggtacacgccggtggccgcggtaaagcgggcggcgtg
aaagtggccaagagcaaggatgagatccgtgcttttgcccaaaactggcttggcaaaaat
ctggtgacctaccagaccgacgccaacggccagccggtcaccaagatcctggtggaatct
tgcaccgacatcgccaaagagctctacctgggcgccgtagttgaccgtggttcgcgccgc
gtggtcttcatggcctcaaccgaaggtggcgtggatatcgagaagatcgcccacgaaacc
ccccatctgatccacaaggcggctatcgatccgctggtgggtccgcaggcttatcaggcc
cgcgaactggccttcaaactgggtctggtcggcgatcagatcaaacagttcaccaagatc
ttcatgggtctgggccagatgttcctggattgcgatttcgcgctgctggagatcaacccg
ctggtgatcaccgcgcagggcaacctgcactgcctggatggcaagatcaacatcgatgcc
aacgcactgtatcgtcagcccaagctgcgcgagatgcacgacccgtcacaagatgacccc
cgcgaagcgcacgccgcccagtgggagctcaactatgtggccctcgatggcaacatcggc
tgcatggtcaacggcgcgggtctggccatgggcaccatggacatcgtcaacctgcacggc
ggcaaaccggccaacttccttgacgtcggcggcggcgccaccaaggagcgcgtaaccgag
gcgttcaagatcatcctctccgacaacaacgtcaaagcggtgctggtcaacatcttcggc
ggcatcgtgcgctgcgacatgatcgcagaaggcatcattggtgcggtcaaggaagtgggg
gtcaaggtgcccgtcgtggtccgtctggaaggcaacaacgccgagctgggtggtatcaag
ctggccgagagcggcctcaacatcattgcggccaagagtctgaccgatgccgcgcagcaa
gtcgtcaaagcagcggaggccaactga

DBGET integrated database retrieval system