KEGG   Aeromonas veronii: B565_1833Help
Entry
B565_1833         CDS       T01462                                 

Definition
6-phosphofructokinase isozyme I
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
avr  Aeromonas veronii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B565_1833
   01230 Biosynthesis of amino acids
    B565_1833
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_1833
   00030 Pentose phosphate pathway
    B565_1833
   00051 Fructose and mannose metabolism
    B565_1833
   00052 Galactose metabolism
    B565_1833
  Energy metabolism
   00680 Methane metabolism
    B565_1833
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    B565_1833
Enzymes [BR:avr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B565_1833
Protein phosphatases and associated proteins [BR:avr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B565_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2043666..2044637)
Genome map
AA seq 323 aa AA seqDB search
MTKQIKRIGVLTSGGDAPGMNAAIRAVVRAGLHHGLEVYGIYDGYLGLHQDRIVKLERHS
VSDVVNRGGTFLGSARFPAFKDPAVRAEAIENLKKHGIDALVVIGGDGSYMGAKKLTEEG
FPCIGLPGTIDNDIAGTDFTIGFDTALNVVVDAIDRLRDTCSSHHRISVVEIMGRHCGDL
AMSAAVAGGAEYVIVPEVAFDKEKLLKQIKEGEAKGKKHAIITICEHVTDVNALAKDIEA
LTGRETRATILGHIQRGGAPTARDRIMSSRMGAYAVEQLLAGHGGRCVGIQRNELVHHDI
IDCIENMKRPFDQELYNLSTTLF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaaatcaaacgtattggtgttttgaccagtggtggcgacgcaccgggtatg
aacgcagccattcgcgccgtggttcgcgccggtttgcatcatggcctggaagtttacggt
atttatgatggctacctcggcctgcaccaggatcgcatcgtcaagctggagcgtcacagc
gtttccgacgtggtgaaccgtggtggtactttcctcggctccgcccgtttccctgccttc
aaagaccccgcagtgcgcgccgaagcgatcgaaaacctgaaaaaacacggtatcgatgcg
ctggtcgtcatcggtggtgacggctcctacatgggtgccaagaagctgaccgaagagggt
ttcccctgcatcggcctgccgggcaccatcgacaacgatatcgccggtaccgacttcacc
atcggctttgataccgctctgaacgtggttgttgacgccatcgaccgcctgcgcgacacc
tgcagctcccaccaccgtatctccgtggtcgagatcatgggtcgccactgtggcgatctg
gccatgtctgccgccgttgccggtggtgccgagtatgtgatcgtgccggaagtagccttc
gataaagagaagctgctcaagcagatcaaggaaggcgaagcaaaaggcaagaagcacgcc
attatcaccatctgtgagcacgtaaccgacgtgaacgcgctggccaaggacatcgaagcc
ctgaccggtcgtgaaacccgcgccaccatcctgggccacatccagcgtggcggtgccccg
actgcccgtgaccgcatcatgtccagccgtatgggtgcttatgccgttgagcagctgctg
gctggtcacggtggtcgctgcgtcggcattcagcgcaacgagctggtacaccacgacatc
atcgactgcatcgagaacatgaagcgtccgttcgatcaggagctttacaacctctccact
accctgttctaa

DBGET integrated database retrieval system