KEGG   Aeromonas veronii: B565_1834Help
Entry
B565_1834         CDS       T01462                                 

Definition
(RefSeq) Triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
avr  Aeromonas veronii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B565_1834
   01230 Biosynthesis of amino acids
    B565_1834
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_1834
   00051 Fructose and mannose metabolism
    B565_1834
   00562 Inositol phosphate metabolism
    B565_1834
Enzymes [BR:avr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     B565_1834
Exosome [BR:avr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   B565_1834
  Exosomal proteins of bladder cancer cells
   B565_1834
  Exosomal proteins of melanoma cells
   B565_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2044787..2045542)
Genome map
AA seq 251 aa AA seqDB search
MRQHLVMGNWKLNGTKASVEALIKGLTPAAAAHPSVQVAVCPPVIFLGLVEQLTAGSKIA
YGAQNADVHESGAFTGENAPSMLKAFGCTYSLVGHSERRTLHAETDDVVAAKYEAIQKGG
LVPVLCIGETLEQFEAGVTKNVVETQLKAVIDRCGIASFNNAVIAYEPVWAIGTGKTATP
EIAQSVHAHIRQYLAGFDAAVAAKVQILYGGSVTGATAADLFGQPDIDGGLVGGASLKVD
DFSQIIAGAAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagacagcacctggtaatgggtaactggaaactgaacggcaccaaggcttctgtagaa
gctctgatcaaaggactgaccccggctgctgccgctcatccttctgtgcaagtcgccgtc
tgcccgccggttatctttttgggtctggttgaacaactgaccgctggcagcaagattgcc
tacggtgcccagaacgctgacgttcacgagtctggtgccttcaccggcgaaaacgccccc
tccatgctgaaagcctttggttgcacctactctctggtcggccacagcgagcgtcgcacc
ctgcacgcagagactgacgacgtggttgctgccaagtacgaagcgatccagaaaggcggc
ctggtgccggttctgtgcatcggtgaaactctggagcagttcgaagccggcgtgaccaag
aacgtggttgagacccagctgaaagccgttatcgaccgttgcggcatcgcctccttcaac
aacgccgttatcgcttacgagccggtatgggccatcggtactggcaagactgccactccg
gagatcgctcagtccgttcacgctcacatccgtcagtacctggccggttttgatgccgct
gttgctgccaaagtacagatcctgtacggcggttccgtcactggcgccactgcagccgac
ctgttcggtcagccggacatcgacggtggcctggtcggtggtgcgtccctgaaagtggac
gacttctcccagatcatcgctggcgctgccaagtaa

DBGET integrated database retrieval system