KEGG   Aeromonas veronii: B565_2506Help
Entry
B565_2506         CDS       T01462                                 

Definition
glycerol 3-phosphotransferase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
avr  Aeromonas veronii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    B565_2506
Enzymes [BR:avr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     B565_2506
Exosome [BR:avr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B565_2506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2814711..2816225
Genome map
AA seq 504 aa AA seqDB search
MENIMSAEKKYVVALDQGTTSSRAIVFDQDANIVGTSQREFTQHYPKAGWVEHDPMEIWA
TQSSVFTEVLAKTGLRSEEIAAIGITNQRETTVVWEKATGKPIYNAIVWQCRRTAAICEE
LKARGLEEYVRENTGLVLDAYFSGTKVKWILDNVEGAREKAMNGELLFGTIDTWLVWKMT
NGEVHVTDPTNASRTMLYNIRELKWDEKMLDELGIPMSMLPEVKPSSEVYGYTTRGGGSR
IPIAGIAGDQQSALFGQLCFEKGMAKNTYGTGCFMLMNTGTEPVRSSNGLLTTVAIGPKG
EVNYALEGAVFMGGATIQWLRDELKIIHDARDTDYFASKVGDTNGVYLVPAFVGLGAPYW
DPYARGTMVGLTRGANRNHIIRAALESIAYQSRDVLDAMQQDSGIKLAALKVDGGAVAND
FLMQFQADMMHTPVVRPTRIETTAMGAAFLAGLAVGFWKSSDELEDKFSVDREFIPQMDR
DDRAKRYSGWQKAVERSRRWAEED
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtggagaacatcatgtctgctgaaaagaaatatgtcgtcgctctggaccagggaaccacc
tcttcccgcgccatcgtgtttgatcaggatgccaacattgtcggtacctcccagcgcgaa
ttcacccagcactacccgaaagcgggctgggtagagcacgacccgatggagatctgggcg
acccaatcctccgtctttaccgaagtgctggccaagaccggccttcgcagcgaagagatc
gccgccatcggtatcaccaaccagcgtgaaaccaccgttgtctgggaaaaggccaccggt
aagcccatctacaacgccatcgtctggcagtgccgccgcaccgccgccatctgcgaagag
ctcaaagctcgcggtctggaagagtacgttcgcgagaacacaggtctggtgctggatgcc
tacttctccggtaccaaggtgaagtggatcctcgacaacgtggaaggtgcccgcgagaag
gcgatgaacggcgagctgctgttcggcaccatcgacacctggctggtctggaaaatgacc
aatggcgaagtacacgtcaccgacccgaccaacgcctcccgtaccatgctctacaacatc
cgcgagctgaagtgggacgagaagatgctggacgagctgggcatccccatgtccatgctg
ccggaagtgaaaccctcttccgaagtgtacggctacaccacccgtggcggcggctcccgc
atccccatcgccggtatcgccggtgaccagcaatctgccctgttcggccagctctgcttt
gaaaaagggatggccaagaacacctacggtaccggctgcttcatgctgatgaacaccggc
accgagccggttcgctccagcaacggcctgctgactaccgttgccatcggcccgaaaggg
gaagtgaactacgcgctggaaggtgcggtattcatgggcggcgccaccatccagtggttg
cgtgacgagctgaagatcatccacgatgcccgcgataccgactacttcgcctccaaggtg
ggcgataccaacggcgtctatctggtaccggccttcgtcggtctgggcgcgccctactgg
gatccgtatgctcgcggcaccatggtcggtctgacccgtggtgccaaccgcaaccacatc
atccgtgctgcgctggaatccatcgcctatcagagccgcgatgtgctggatgcgatgcag
caggactccggcatcaagctggcagccctcaaggtagacggcggcgccgtagccaacgac
ttcctgatgcagttccaggctgacatgatgcacaccccggtggtgcgtccgacccgcatc
gagaccaccgccatgggcgccgccttcctggcgggtctggcagtcggcttctggaagagc
tcggacgagctggaagataagttcagcgttgaccgcgagttcatcccgcagatggacaga
gacgatcgcgccaaacgttacagcggctggcagaaagcggttgagcgttcacgccgttgg
gctgaagaggattga

  All links  
No link information was found.   
DBGET integrated database retrieval system