KEGG   Aeromonas veronii: B565_2557Help
Entry
B565_2557         CDS       T01462                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
avr  Aeromonas veronii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B565_2557
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B565_2557
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B565_2557
Enzymes [BR:avr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B565_2557
Exosome [BR:avr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B565_2557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2868909..2870306
Genome map
AA seq 465 aa AA seqDB search
MRKMAGLAVMIGAALAAGCKSDNDTVATKPAAQPTNVIFFLGDGMGLNTLTAARIYGVGE
EGDLTIDTLPETAFIKTFSHDAQVTDSAPSMAAYMTGVKSNNGVISMDGDATYESDCSKS
AGKPVTTLLELAKADGRGTGVVTSTRVTHATPAATYAHICNRDLEADIAVQLVPGGKGYN
SALKEGLDVVLGGGSSFFLPKADKGKREDGRNLISEMQAKGYQFASNLDELNKADAGKPL
LGLFGSSHMKYDLDRPASEPSLAQMTLAAIKQLKGKEKGYFLMVEGGRIDHALHDTNAKR
ALQDTIAFDNAIKAAIDEVKKSDPELKNTLIVVTADHDHTLVLNGYAKRTGKTTADNPGV
LGLVRNYETGEPSKDSEGMPYTIIGFGNGYNRVDGPRSSVAPLDDATVSANDYHQEVVVK
VGEIGNETHGGTDVFLGAIGKGADSFHGSLDNTAVFGKIKAAAKL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatggcaggacttgcagtgatgatcggcgccgccctggctgccggctgcaaa
tcagacaatgacacggtggcgaccaagcccgcagcccaacccaccaacgtcatcttcttc
ctcggtgacggcatgggcctcaacaccctgacggcggcccgcatctacggtgtcggcgaa
gagggtgatctcaccatcgataccctgccagagacggcctttatcaagaccttctcccac
gatgcccaggtcactgactcggccccctccatggcggcctacatgaccggggtcaagagc
aacaacggcgtcatcagcatggacggcgacgccacctatgagagcgactgcagcaagagc
gccggcaagccggtgacaaccctgctggagctggccaaagccgatggccgcggtaccggt
gtggtaaccagcacccgggtaacccacgccaccccggcggctacctatgcccatatctgc
aaccgggatctggaggcggatatcgccgtccagctggtaccgggcggcaaaggctacaac
agcgccctcaaggaggggctggatgtggtgctcggtggcggcagcagtttcttcctgccc
aaagccgacaagggcaagcgggaggatggccgcaacctcatcagcgaaatgcaggccaag
ggctaccagtttgccagcaatctggatgagctgaacaaggccgatgcgggcaagccgctg
ctgggcctgtttggttccagccacatgaaatatgacctggaccgtcccgccagcgagccg
tcactggcccagatgaccttggccgccatcaagcagctcaagggcaaagagaagggttac
ttcctgatggtggaagggggccgtatcgaccacgccctgcacgacaccaacgccaagcgg
gcgctgcaggacaccatagccttcgacaacgccatcaaggctgctatcgacgaggtgaaa
aagagcgaccccgagctgaaaaacaccctgatcgtggtcaccgccgatcacgaccacacg
ctagtgctcaacggctatgccaagcgcaccggcaagaccaccgccgacaaccccggcgta
ctcgggctggtgaggaactacgagactggcgagccaagcaaggatagcgagggtatgccc
tacaccatcatcggttttggcaacggctacaaccgggtagatggcccgcgcagcagcgtc
gccccgctcgacgatgccaccgtctccgccaatgactaccaccaggaagtggtggtcaag
gtaggcgagatcggcaacgagacccacggcggcaccgatgtcttcctcggcgccatcggc
aagggggctgacagcttccatggctctctcgataacaccgccgtgttcggcaagatcaag
gctgcggccaagctgtaa

DBGET integrated database retrieval system