KEGG   Aeromonas veronii: B565_2557Help
Entry
B565_2557         CDS       T01462                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
avr  Aeromonas veronii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:avr00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:avr00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:avr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2868909..2870306
Genome map
AA seq 465 aa AA seqDB search
MRKMAGLAVMIGAALAAGCKSDNDTVATKPAAQPTNVIFFLGDGMGLNTLTAARIYGVGE
EGDLTIDTLPETAFIKTFSHDAQVTDSAPSMAAYMTGVKSNNGVISMDGDATYESDCSKS
AGKPVTTLLELAKADGRGTGVVTSTRVTHATPAATYAHICNRDLEADIAVQLVPGGKGYN
SALKEGLDVVLGGGSSFFLPKADKGKREDGRNLISEMQAKGYQFASNLDELNKADAGKPL
LGLFGSSHMKYDLDRPASEPSLAQMTLAAIKQLKGKEKGYFLMVEGGRIDHALHDTNAKR
ALQDTIAFDNAIKAAIDEVKKSDPELKNTLIVVTADHDHTLVLNGYAKRTGKTTADNPGV
LGLVRNYETGEPSKDSEGMPYTIIGFGNGYNRVDGPRSSVAPLDDATVSANDYHQEVVVK
VGEIGNETHGGTDVFLGAIGKGADSFHGSLDNTAVFGKIKAAAKL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatggcaggacttgcagtgatgatcggcgccgccctggctgccggctgcaaa
tcagacaatgacacggtggcgaccaagcccgcagcccaacccaccaacgtcatcttcttc
ctcggtgacggcatgggcctcaacaccctgacggcggcccgcatctacggtgtcggcgaa
gagggtgatctcaccatcgataccctgccagagacggcctttatcaagaccttctcccac
gatgcccaggtcactgactcggccccctccatggcggcctacatgaccggggtcaagagc
aacaacggcgtcatcagcatggacggcgacgccacctatgagagcgactgcagcaagagc
gccggcaagccggtgacaaccctgctggagctggccaaagccgatggccgcggtaccggt
gtggtaaccagcacccgggtaacccacgccaccccggcggctacctatgcccatatctgc
aaccgggatctggaggcggatatcgccgtccagctggtaccgggcggcaaaggctacaac
agcgccctcaaggaggggctggatgtggtgctcggtggcggcagcagtttcttcctgccc
aaagccgacaagggcaagcgggaggatggccgcaacctcatcagcgaaatgcaggccaag
ggctaccagtttgccagcaatctggatgagctgaacaaggccgatgcgggcaagccgctg
ctgggcctgtttggttccagccacatgaaatatgacctggaccgtcccgccagcgagccg
tcactggcccagatgaccttggccgccatcaagcagctcaagggcaaagagaagggttac
ttcctgatggtggaagggggccgtatcgaccacgccctgcacgacaccaacgccaagcgg
gcgctgcaggacaccatagccttcgacaacgccatcaaggctgctatcgacgaggtgaaa
aagagcgaccccgagctgaaaaacaccctgatcgtggtcaccgccgatcacgaccacacg
ctagtgctcaacggctatgccaagcgcaccggcaagaccaccgccgacaaccccggcgta
ctcgggctggtgaggaactacgagactggcgagccaagcaaggatagcgagggtatgccc
tacaccatcatcggttttggcaacggctacaaccgggtagatggcccgcgcagcagcgtc
gccccgctcgacgatgccaccgtctccgccaatgactaccaccaggaagtggtggtcaag
gtaggcgagatcggcaacgagacccacggcggcaccgatgtcttcctcggcgccatcggc
aagggggctgacagcttccatggctctctcgataacaccgccgtgttcggcaagatcaag
gctgcggccaagctgtaa

DBGET integrated database retrieval system