KEGG   Aeromonas veronii: B565_2580Help
Entry
B565_2580         CDS       T01462                                 

Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
avr  Aeromonas veronii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B565_2580
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B565_2580
   00630 Glyoxylate and dicarboxylate metabolism
    B565_2580
Enzymes [BR:avr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     B565_2580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2896663..2898270
Genome map
AA seq 535 aa AA seqDB search
MSAPAQTHCSARLRIQGEMQPEYAQILTPDAVALISELVERFAPQRGELLKQRVARQARI
DGGELPDFLPETAHIREGDWTIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADF
EDSLAPAWNKVIEGQINLRDAVNETISYTSPEGKAYTLTPNPAVLICRVRGLHLPEKHVT
FDGEPIPGGLFDFALYFLHNYQALLAKGSGPYFYVPKLQSHLEGRWWSEVFAWTEDKFGL
PRGTIKATVLIETLPAVFEMDELLYQMKDHIVALNCGRWDYIFSYIKTLKNHPDRVLPDR
QVVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDAAVNKQVFAKVKADKEREAN
NGHDGTWVAHPGLADTAMAVFNATIAAGAKNQIGVLREQDAPITAADLLAPCEGERTEAG
MRTNIRVALQYLEAWINGNGCVPIYGLMEDAATAEISRTSIWQWIRHGKSLSNGKVVTKE
LFRQMLAEELEVVKAEVGTARWQAGRFAEASELMEEITCADTLIDFLTLPGYERL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaccggctcagacccactgcagcgcccgccttcgcatccagggcgagatgcag
cccgaatacgcgcaaattctgacgccggacgcggtggctctgatctccgaactggtggaa
cgttttgctccccaaagaggggaattgctgaaacaacgtgtggcacgccaggcccgtatc
gatggcggcgagctgccggacttcctgccggaaaccgcccacatccgtgaaggtgactgg
accattcgcggcattcccgccgacctgcaagaccgccgtgtggagatcaccggcccggtc
gagcgcaagatggtgatcaacgccctcaacgccaacgtcaaggtgtttatggcggacttc
gaggactcactggcccccgcctggaacaaggtgatcgagggtcaaatcaacctgcgcgat
gcagtcaacgagaccatttcttacaccagtccggaaggaaaggcttataccctgaccccc
aatccggcggtactcatctgccgggtacgcggtctgcacctgccggaaaaacatgtcacc
ttcgatggcgagcccatccccggcggcctgttcgattttgctctctacttcctgcacaac
tatcaggcgctgctggccaaaggctcgggcccctacttctacgtgcccaagttgcagagc
catctggaagggcgctggtggagcgaggtattcgcctggaccgaggacaagttcggcctg
ccccgcggcaccatcaaggccaccgtgctgattgaaaccctgccagccgtattcgagatg
gatgagctgctttatcagatgaaagatcacatcgttgcgctgaactgcggccgctgggac
tacatcttcagctatatcaaaaccttgaagaaccatccggatcgggtactgcctgatcgt
caggtggtgaccatggacaagccgttcctctccgcctactcgcggctgctgatcaagacc
tgtcacaagcgcggtgcgctggcgatgggtggcatggccgcctttattccggccaaagac
gcggccgtcaacaagcaggtcttcgccaaggtcaaggccgacaaggagcgcgaagccaac
aacggccacgacggtacctgggtcgcccaccctggccttgccgacaccgccatggcggtg
ttcaacgccaccattgctgctggtgccaagaaccagatcggagtgctgcgcgagcaggat
gcccccatcactgccgccgacctgctggccccctgtgagggcgagcggaccgaagcaggc
atgcgtacaaatatccgggtcgccctgcaatatctggaggcctggatcaacggcaacggc
tgcgtgcccatctacggtctgatggaagatgccgccaccgccgagatctcccgcacctcc
atctggcagtggatccgccacggcaagagtctgtcgaatggcaaggtggtgaccaaggag
ctgttccgccagatgctggccgaggagttggaggtggtcaaagccgaggtgggtactgcg
cgctggcaggcaggacgctttgccgaggcaagcgagctgatggaagagatcacctgcgcc
gataccctgatcgattttctgacgctgcccggttacgagcggctctga

DBGET integrated database retrieval system