KEGG   Aeromonas veronii: B565_2580Help
Entry
B565_2580         CDS       T01462                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
avr  Aeromonas veronii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:avr01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:avr00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:avr00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2896663..2898270
Genome map
AA seq 535 aa AA seqDB search
MSAPAQTHCSARLRIQGEMQPEYAQILTPDAVALISELVERFAPQRGELLKQRVARQARI
DGGELPDFLPETAHIREGDWTIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADF
EDSLAPAWNKVIEGQINLRDAVNETISYTSPEGKAYTLTPNPAVLICRVRGLHLPEKHVT
FDGEPIPGGLFDFALYFLHNYQALLAKGSGPYFYVPKLQSHLEGRWWSEVFAWTEDKFGL
PRGTIKATVLIETLPAVFEMDELLYQMKDHIVALNCGRWDYIFSYIKTLKNHPDRVLPDR
QVVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDAAVNKQVFAKVKADKEREAN
NGHDGTWVAHPGLADTAMAVFNATIAAGAKNQIGVLREQDAPITAADLLAPCEGERTEAG
MRTNIRVALQYLEAWINGNGCVPIYGLMEDAATAEISRTSIWQWIRHGKSLSNGKVVTKE
LFRQMLAEELEVVKAEVGTARWQAGRFAEASELMEEITCADTLIDFLTLPGYERL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaccggctcagacccactgcagcgcccgccttcgcatccagggcgagatgcag
cccgaatacgcgcaaattctgacgccggacgcggtggctctgatctccgaactggtggaa
cgttttgctccccaaagaggggaattgctgaaacaacgtgtggcacgccaggcccgtatc
gatggcggcgagctgccggacttcctgccggaaaccgcccacatccgtgaaggtgactgg
accattcgcggcattcccgccgacctgcaagaccgccgtgtggagatcaccggcccggtc
gagcgcaagatggtgatcaacgccctcaacgccaacgtcaaggtgtttatggcggacttc
gaggactcactggcccccgcctggaacaaggtgatcgagggtcaaatcaacctgcgcgat
gcagtcaacgagaccatttcttacaccagtccggaaggaaaggcttataccctgaccccc
aatccggcggtactcatctgccgggtacgcggtctgcacctgccggaaaaacatgtcacc
ttcgatggcgagcccatccccggcggcctgttcgattttgctctctacttcctgcacaac
tatcaggcgctgctggccaaaggctcgggcccctacttctacgtgcccaagttgcagagc
catctggaagggcgctggtggagcgaggtattcgcctggaccgaggacaagttcggcctg
ccccgcggcaccatcaaggccaccgtgctgattgaaaccctgccagccgtattcgagatg
gatgagctgctttatcagatgaaagatcacatcgttgcgctgaactgcggccgctgggac
tacatcttcagctatatcaaaaccttgaagaaccatccggatcgggtactgcctgatcgt
caggtggtgaccatggacaagccgttcctctccgcctactcgcggctgctgatcaagacc
tgtcacaagcgcggtgcgctggcgatgggtggcatggccgcctttattccggccaaagac
gcggccgtcaacaagcaggtcttcgccaaggtcaaggccgacaaggagcgcgaagccaac
aacggccacgacggtacctgggtcgcccaccctggccttgccgacaccgccatggcggtg
ttcaacgccaccattgctgctggtgccaagaaccagatcggagtgctgcgcgagcaggat
gcccccatcactgccgccgacctgctggccccctgtgagggcgagcggaccgaagcaggc
atgcgtacaaatatccgggtcgccctgcaatatctggaggcctggatcaacggcaacggc
tgcgtgcccatctacggtctgatggaagatgccgccaccgccgagatctcccgcacctcc
atctggcagtggatccgccacggcaagagtctgtcgaatggcaaggtggtgaccaaggag
ctgttccgccagatgctggccgaggagttggaggtggtcaaagccgaggtgggtactgcg
cgctggcaggcaggacgctttgccgaggcaagcgagctgatggaagagatcacctgcgcc
gataccctgatcgattttctgacgctgcccggttacgagcggctctga

DBGET integrated database retrieval system