KEGG   Aeromonas veronii B565: B565_2629Help
Entry
B565_2629         CDS       T01462                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
avr  Aeromonas veronii B565
Pathway
avr00010  Glycolysis / Gluconeogenesis
avr00020  Citrate cycle (TCA cycle)
avr00620  Pyruvate metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
Module
avr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_2629
   00020 Citrate cycle (TCA cycle)
    B565_2629
   00620 Pyruvate metabolism
    B565_2629
Enzymes [BR:avr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B565_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding OB_aCoA_assoc GCV_H
Motif
Other DBs
NCBI-ProteinID: AEB50664
Position
complement(2947244..2948344)
Genome map
AA seq 366 aa AA seqDB search
MKFFKLPDLGEGLAEAEIVEWKVSAGDTVTVDQVLLSVETAKALVDVPSPVAGVIARLCG
AEGDILHIGAPLVEFEGGEDDGTVVGKVSAHQQHIEDHFVVGAIAPGGALVQAMPAVRLL
AQKLGVDIDRIKGSGSGGMVTELDVQQAFESQQSSGNEFLKGSRRAMAKAMELSHQTVVP
VSITDEVDLRHWRPDEDVTVRLIKAIGVACRAEPSMNAWFDGDTLSRRLFKEVNVAIAVD
SKHGLYVPVMENVAEREGTDIRQGLDRMIADVKARAVPREMLLGATITLTNFGAIAGRYA
SPIVTPPQVAIIGAGKLFEKVVFIHGEARPVRALPLSMTFDHRACTGGEAARFLRALVEA
LEAATL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttcaaattaccggatctgggtgaagggttggccgaagccgagatcgtcgag
tggaaggtgagtgccggtgataccgtcacggtcgatcaggtgctcttgtcggtggaaacg
gccaaagcgctggtggatgtgccctctccggtggccggggtgattgcccgtctctgcggc
gccgagggggatatcctccatatcggtgcgccgctggtggagttcgaggggggcgaagat
gatgggaccgtggtgggcaaggtgagcgcccatcagcaacatatcgaggatcatttcgtg
gtgggggccattgccccgggtggcgcgctggtgcaagccatgcctgccgtgcgcctgctt
gcacaaaaactgggtgtggatatcgaccggatcaaggggagtggcagcggcggaatggtg
accgagctggatgtgcagcaggcattcgagtcacagcagagcagtggcaacgaattcctc
aaagggtcgcggagggccatggccaaggcgatggagctctctcatcagactgtggtgccg
gtcagcatcaccgacgaggtggatttgcgtcactggcggcctgatgaggatgtgacggtg
cgccttatcaaggccattggcgtggcgtgccgcgccgagccctcgatgaacgcctggttc
gatggcgacaccctgtcacggcgtctgtttaaagaggtcaatgtggccatcgcggtggat
tcaaagcatggcctctatgtgccggtgatggagaacgtggccgagcgggaggggacagat
atccggcaggggctggatcggatgatcgccgatgtgaaggcgcgcgccgtgccgcgcgaa
atgttgctgggggcgaccattacgctcaccaacttcggtgccatcgcaggccgttatgcc
agccccatcgtcacgccgccgcaggtggccatcataggggcaggcaaactgttcgaaaaa
gtggtgttcatccatggggaggctcgccccgtcagggcattgccgctgtcgatgacattt
gaccacagagcctgtaccggcggcgaggcggctcgttttctcagagcgctggtcgaagcg
ttggaagcagccaccttataa

DBGET integrated database retrieval system