KEGG   Aeromonas veronii: B565_2811Help
Entry
B565_2811         CDS       T01462                                 

Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
avr  Aeromonas veronii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B565_2811
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B565_2811
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B565_2811
Enzymes [BR:avr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B565_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3164448..3165722)
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKDNSEQVSFAQAVRQGLGREQGLFFPEQLEPLADVDALLDLPLAERSARILSHL
LGDEVPAAKVSELVNAAFTFPAPLVKLKDNTYALELFHGPTLAFKDFGGRFMAQCLAAFR
TNDKITILTATSGDTGAAVAHAFYGLEGIEVVILYPKGKISPLQEKLFCTLGGNIRTIAI
DGDFDACQALVKQAFDDEALKKAIGLNSANSINISRLLAQVCYYFEAVAQLPKADRAKAV
ISVPSGNFGNLTAGLIAKALGLPVKRFIAATNANDTVPRYLKTGQWEPHQTVATLSNAMD
VSRPNNWPRVEELCRRKGWALETLGSGMRDDAQTRAALKRLHQLDYLCEPHGAIAWDLLG
EQLAEDEVGVFLCTAHPAKFKESVDEILNLDVPLPGPLAKHAELPLLSVNLPAEFARLRA
FLVG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatctctacaacatcaaggacaacagcgaacaggtgagcttcgcgcaggcggtgcgt
cagggcttgggtcgcgaacaggggctcttcttccccgaacaactcgaaccgctcgccgat
gtggatgccctgctcgatctgccgctggccgaacgctctgcccgcatcctgagccacctg
ttgggggacgaagtgcccgcagcgaaagtgagcgagcttgtcaacgccgccttcaccttc
ccggcgccgctggtgaagctcaaggacaacacctatgcccttgagctgttccacggcccg
actctggcgttcaaggatttcggcggccgctttatggcccagtgcctcgcggcgtttaga
accaacgacaagattactatcctcaccgccacctccggcgacaccggcgccgccgtggcc
cacgccttctacgggctggaggggatcgaggtggtgatcctctatcccaaaggcaagata
agcccgctgcaggagaagctcttctgcaccctcggcggcaatatccgcaccatcgccatc
gacggcgacttcgatgcttgtcaggcgctggtaaaacaggcctttgacgacgaagcgctg
aaaaaggccattggcctcaactccgccaactccatcaatatcagccgtctgctggcgcag
gtttgctactacttcgaagcggtggcccagttgcccaaggccgatcgcgccaaggcggtc
atcagcgtgccgtccggcaactttggcaacctcaccgcaggcctgatcgccaaggcgctg
gggctgccggtgaagcgctttatcgccgccaccaacgccaacgataccgtgccgcgctac
ctgaaaaccggtcagtgggagccgcatcagacagtggccaccctgtcgaacgccatggat
gtcagtcgccccaacaactggccgcgagtggaagagctttgccgtcgcaagggctgggcg
ctggagaccctggggtcaggcatgcgtgacgacgcccagacccgcgctgcccttaaacgg
ctgcaccagctggattacctctgcgaaccccacggcgccattgcctgggatctgctgggt
gaacagctggccgaagatgaagtgggggtgttcctctgcaccgcccatcccgccaagttc
aaggagtcggtggacgagatcctcaatctcgatgtaccgctacccggcccgctcgccaaa
cacgccgagctgccgctgctctccgttaatttgcccgcggagtttgcccggttaagggcg
tttttggtgggttaa

DBGET integrated database retrieval system